Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4099
Gene name
Locationscaffold_320:14102..15773
Strand-
Gene length (bp)1671
Transcript length (bp)1671
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10998 DUF2838 Protein of unknown function (DUF2838) 1.9E-45 168 278

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94673|YG75_SCHPO Uncharacterized membrane protein C776.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.05 PE=4 SV=2 60 456 9.0E-101
sp|P48236|YG3L_YEAST Uncharacterized membrane protein YGR149W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR149W PE=1 SV=1 79 458 3.0E-71

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 174 196 22
2 216 238 22
3 245 264 19
4 279 298 19
5 319 341 22
6 389 411 22
7 418 440 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4099
MDSEKQARELDASSDPEADAEPDVPMPPGLSTDGAASPESLVLEDTAPSRRRLSRNPSYSESSSHQDDWDSLPPL
DRLTVLDFLDNLALPQQLEKLQKGISAQKEKVRRSKDALKSKTQLARDRMVEEWRRRAPSADEQLERYKMRMRRR
VDKLGQHWSDTKAISIREKISFICGVMNIFISGYLIGGFPQYFHIWYTAQLVYFMPLRFFTYHRQGYHYFLADLC
YFVNVLLSLSIWVFPSSKRLFTAAYCLAFGNNAVAIIMWRNSLVFHSLDKVTSLFIHIMPCATLHCLVHLLPAEQ
QERRFPAIWTIRNSTPDSPTAYANVTSMLTWSTIPYVLWQLSYYFLITVRRREKIAAGRPTSFTWMRRSYSQTWI
GKLVISLPDTLHEPAFMMIQYSYAALTMLPCPLWFVSRLASSVFLLVLFAWSIYNGSTYYIDVFGKRFQKELEAM
KAEVSKWQNTPDLALQSPLMTPHHEEAPTQTSTRKDAHSSDSTAERKIDHSPASGDPLPDTNKLSSVGLEQIPLL
DESPKSTAVCPEGVVQNATQRRSFQGGIEVA
Coding >Ophio5|4099
ATGGATTCTGAGAAGCAGGCCAGAGAGCTTGACGCGAGTTCCGATCCCGAGGCAGATGCGGAGCCCGACGTCCCG
ATGCCACCCGGGCTGTCGACCGACGGCGCTGCCTCTCCCGAGTCGCTGGTCCTGGAGGACACCGCTCCGAGCCGG
CGGAGGCTTTCGCGGAATCCGTCGTACTCCGAAAGCAGCTCGCATCAAGACGACTGGGACTCTCTACCCCCGCTC
GACAGGCTGACCGTCCTTGACTTCCTCGACAACCTCGCGCTGCCGCAGCAGCTCGAGAAACTCCAAAAAGGCATC
TCAGCCCAGAAGGAGAAAGTGCGACGGTCCAAAGATGCTCTCAAGTCCAAAACACAGCTTGCCCGCGATCGCATG
GTGGAAGAGTGGCGTCGTCGCGCCCCTTCGGCCGATGAGCAGCTTGAGCGGTACAAGATGCGCATGCGCCGCCGC
GTCGATAAACTCGGGCAGCACTGGAGCGACACAAAGGCCATCAGCATACGCGAAAAGATATCCTTCATCTGCGGC
GTCATGAACATCTTCATCAGCGGCTACCTGATTGGCGGCTTTCCCCAATATTTCCACATCTGGTATACGGCTCAG
CTTGTCTATTTCATGCCCCTCCGCTTTTTCACATACCATCGGCAAGGCTACCACTACTTTCTCGCCGACCTCTGC
TACTTCGTCAATGTGTTGCTGAGTCTCAGCATTTGGGTCTTTCCCTCCTCCAAGCGCCTCTTCACCGCCGCTTAC
TGCCTGGCTTTTGGCAACAATGCCGTGGCAATCATCATGTGGAGAAATTCTCTCGTCTTCCACAGCCTCGACAAA
GTCACCTCGCTCTTCATCCACATCATGCCATGCGCCACGCTTCACTGCCTCGTCCATCTCCTGCCCGCTGAGCAG
CAGGAGCGCAGGTTTCCCGCCATCTGGACCATCAGAAACTCGACTCCTGACTCGCCGACGGCTTACGCAAACGTC
ACTTCCATGTTGACCTGGAGCACTATCCCCTACGTCTTATGGCAGCTGAGTTACTACTTCCTGATCACGGTCCGT
CGCCGAGAGAAGATTGCCGCCGGGCGGCCTACGTCCTTCACCTGGATGCGCCGATCCTACTCCCAGACCTGGATA
GGCAAGCTGGTAATATCTCTACCAGACACGTTGCACGAGCCGGCTTTCATGATGATCCAGTACAGCTACGCTGCG
TTGACCATGCTACCATGTCCCCTGTGGTTTGTAAGCCGTCTCGCCTCTTCTGTCTTCCTCTTGGTGCTCTTTGCC
TGGAGCATATACAATGGCTCAACCTATTACATCGATGTCTTCGGCAAGCGCTTCCAGAAGGAGCTCGAAGCCATG
AAAGCCGAGGTCTCGAAATGGCAAAATACACCGGATCTGGCCCTCCAATCCCCATTGATGACTCCGCATCACGAG
GAGGCCCCTACCCAGACATCTACGCGGAAGGATGCGCACTCGTCAGACTCGACCGCCGAAAGGAAGATAGACCAC
AGCCCGGCAAGCGGTGATCCTTTGCCAGATACAAACAAACTTTCCAGTGTGGGACTCGAGCAAATACCGCTTCTG
GACGAGAGTCCGAAATCGACAGCCGTATGCCCCGAGGGCGTTGTTCAGAATGCCACTCAGAGGAGAAGCTTTCAA
GGCGGCATAGAGGTCGCG
Transcript >Ophio5|4099
ATGGATTCTGAGAAGCAGGCCAGAGAGCTTGACGCGAGTTCCGATCCCGAGGCAGATGCGGAGCCCGACGTCCCG
ATGCCACCCGGGCTGTCGACCGACGGCGCTGCCTCTCCCGAGTCGCTGGTCCTGGAGGACACCGCTCCGAGCCGG
CGGAGGCTTTCGCGGAATCCGTCGTACTCCGAAAGCAGCTCGCATCAAGACGACTGGGACTCTCTACCCCCGCTC
GACAGGCTGACCGTCCTTGACTTCCTCGACAACCTCGCGCTGCCGCAGCAGCTCGAGAAACTCCAAAAAGGCATC
TCAGCCCAGAAGGAGAAAGTGCGACGGTCCAAAGATGCTCTCAAGTCCAAAACACAGCTTGCCCGCGATCGCATG
GTGGAAGAGTGGCGTCGTCGCGCCCCTTCGGCCGATGAGCAGCTTGAGCGGTACAAGATGCGCATGCGCCGCCGC
GTCGATAAACTCGGGCAGCACTGGAGCGACACAAAGGCCATCAGCATACGCGAAAAGATATCCTTCATCTGCGGC
GTCATGAACATCTTCATCAGCGGCTACCTGATTGGCGGCTTTCCCCAATATTTCCACATCTGGTATACGGCTCAG
CTTGTCTATTTCATGCCCCTCCGCTTTTTCACATACCATCGGCAAGGCTACCACTACTTTCTCGCCGACCTCTGC
TACTTCGTCAATGTGTTGCTGAGTCTCAGCATTTGGGTCTTTCCCTCCTCCAAGCGCCTCTTCACCGCCGCTTAC
TGCCTGGCTTTTGGCAACAATGCCGTGGCAATCATCATGTGGAGAAATTCTCTCGTCTTCCACAGCCTCGACAAA
GTCACCTCGCTCTTCATCCACATCATGCCATGCGCCACGCTTCACTGCCTCGTCCATCTCCTGCCCGCTGAGCAG
CAGGAGCGCAGGTTTCCCGCCATCTGGACCATCAGAAACTCGACTCCTGACTCGCCGACGGCTTACGCAAACGTC
ACTTCCATGTTGACCTGGAGCACTATCCCCTACGTCTTATGGCAGCTGAGTTACTACTTCCTGATCACGGTCCGT
CGCCGAGAGAAGATTGCCGCCGGGCGGCCTACGTCCTTCACCTGGATGCGCCGATCCTACTCCCAGACCTGGATA
GGCAAGCTGGTAATATCTCTACCAGACACGTTGCACGAGCCGGCTTTCATGATGATCCAGTACAGCTACGCTGCG
TTGACCATGCTACCATGTCCCCTGTGGTTTGTAAGCCGTCTCGCCTCTTCTGTCTTCCTCTTGGTGCTCTTTGCC
TGGAGCATATACAATGGCTCAACCTATTACATCGATGTCTTCGGCAAGCGCTTCCAGAAGGAGCTCGAAGCCATG
AAAGCCGAGGTCTCGAAATGGCAAAATACACCGGATCTGGCCCTCCAATCCCCATTGATGACTCCGCATCACGAG
GAGGCCCCTACCCAGACATCTACGCGGAAGGATGCGCACTCGTCAGACTCGACCGCCGAAAGGAAGATAGACCAC
AGCCCGGCAAGCGGTGATCCTTTGCCAGATACAAACAAACTTTCCAGTGTGGGACTCGAGCAAATACCGCTTCTG
GACGAGAGTCCGAAATCGACAGCCGTATGCCCCGAGGGCGTTGTTCAGAATGCCACTCAGAGGAGAAGCTTTCAA
GGCGGCATAGAGGTCGCGTGA
Gene >Ophio5|4099
ATGGATTCTGAGAAGCAGGCCAGAGAGCTTGACGCGAGTTCCGATCCCGAGGCAGATGCGGAGCCCGACGTCCCG
ATGCCACCCGGGCTGTCGACCGACGGCGCTGCCTCTCCCGAGTCGCTGGTCCTGGAGGACACCGCTCCGAGCCGG
CGGAGGCTTTCGCGGAATCCGTCGTACTCCGAAAGCAGCTCGCATCAAGACGACTGGGACTCTCTACCCCCGCTC
GACAGGCTGACCGTCCTTGACTTCCTCGACAACCTCGCGCTGCCGCAGCAGCTCGAGAAACTCCAAAAAGGCATC
TCAGCCCAGAAGGAGAAAGTGCGACGGTCCAAAGATGCTCTCAAGTCCAAAACACAGCTTGCCCGCGATCGCATG
GTGGAAGAGTGGCGTCGTCGCGCCCCTTCGGCCGATGAGCAGCTTGAGCGGTACAAGATGCGCATGCGCCGCCGC
GTCGATAAACTCGGGCAGCACTGGAGCGACACAAAGGCCATCAGCATACGCGAAAAGATATCCTTCATCTGCGGC
GTCATGAACATCTTCATCAGCGGCTACCTGATTGGCGGCTTTCCCCAATATTTCCACATCTGGTATACGGCTCAG
CTTGTCTATTTCATGCCCCTCCGCTTTTTCACATACCATCGGCAAGGCTACCACTACTTTCTCGCCGACCTCTGC
TACTTCGTCAATGTGTTGCTGAGTCTCAGCATTTGGGTCTTTCCCTCCTCCAAGCGCCTCTTCACCGCCGCTTAC
TGCCTGGCTTTTGGCAACAATGCCGTGGCAATCATCATGTGGAGAAATTCTCTCGTCTTCCACAGCCTCGACAAA
GTCACCTCGCTCTTCATCCACATCATGCCATGCGCCACGCTTCACTGCCTCGTCCATCTCCTGCCCGCTGAGCAG
CAGGAGCGCAGGTTTCCCGCCATCTGGACCATCAGAAACTCGACTCCTGACTCGCCGACGGCTTACGCAAACGTC
ACTTCCATGTTGACCTGGAGCACTATCCCCTACGTCTTATGGCAGCTGAGTTACTACTTCCTGATCACGGTCCGT
CGCCGAGAGAAGATTGCCGCCGGGCGGCCTACGTCCTTCACCTGGATGCGCCGATCCTACTCCCAGACCTGGATA
GGCAAGCTGGTAATATCTCTACCAGACACGTTGCACGAGCCGGCTTTCATGATGATCCAGTACAGCTACGCTGCG
TTGACCATGCTACCATGTCCCCTGTGGTTTGTAAGCCGTCTCGCCTCTTCTGTCTTCCTCTTGGTGCTCTTTGCC
TGGAGCATATACAATGGCTCAACCTATTACATCGATGTCTTCGGCAAGCGCTTCCAGAAGGAGCTCGAAGCCATG
AAAGCCGAGGTCTCGAAATGGCAAAATACACCGGATCTGGCCCTCCAATCCCCATTGATGACTCCGCATCACGAG
GAGGCCCCTACCCAGACATCTACGCGGAAGGATGCGCACTCGTCAGACTCGACCGCCGAAAGGAAGATAGACCAC
AGCCCGGCAAGCGGTGATCCTTTGCCAGATACAAACAAACTTTCCAGTGTGGGACTCGAGCAAATACCGCTTCTG
GACGAGAGTCCGAAATCGACAGCCGTATGCCCCGAGGGCGTTGTTCAGAATGCCACTCAGAGGAGAAGCTTTCAA
GGCGGCATAGAGGTCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail