Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4095
Gene name
Locationscaffold_320:5604..6234
Strand-
Gene length (bp)630
Transcript length (bp)453
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01124 MAPEG MAPEG family 3.7E-22 15 141

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q3T100|MGST3_BOVIN Microsomal glutathione S-transferase 3 OS=Bos taurus GN=MGST3 PE=2 SV=1 7 126 1.0E-14
sp|O14880|MGST3_HUMAN Microsomal glutathione S-transferase 3 OS=Homo sapiens GN=MGST3 PE=1 SV=1 7 127 4.0E-14
sp|Q9CPU4|MGST3_MOUSE Microsomal glutathione S-transferase 3 OS=Mus musculus GN=Mgst3 PE=1 SV=1 7 127 4.0E-14

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 27 17
2 79 101 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4095
MAPTLQLPDQYGLVLAAATSTFFVNTLHAFRTIKFRKASGIEYPQAYATNEQAAKNESAYRFNCAQRAHHNFTEN
HTSLLGALLIAGIRFPVPAAAVGAGWSLSRVLYLLGYTSSAGPRGRLIGGLGGTLSDLLLKLAAAYSSAMFVLGN
Coding >Ophio5|4095
ATGGCGCCAACCCTGCAACTCCCCGATCAGTATGGGCTTGTGCTCGCCGCCGCCACGAGCACCTTCTTCGTCAAC
ACTCTCCACGCTTTCCGTACCATAAAGTTTCGCAAGGCCAGCGGAATCGAGTATCCTCAAGCCTATGCAACCAAC
GAGCAGGCGGCTAAGAATGAGAGTGCCTACCGTTTCAACTGCGCTCAGCGAGCTCATCATAACTTCACCGAAAAC
CACACATCCCTTCTCGGTGCCCTCCTTATTGCTGGCATTCGGTTCCCTGTTCCCGCCGCCGCCGTCGGAGCCGGC
TGGAGTCTGTCCAGAGTCCTGTACCTTCTCGGCTACACCAGCTCCGCCGGCCCTCGCGGCCGCCTAATCGGCGGG
CTTGGCGGCACCTTGAGTGACTTGCTCCTCAAACTCGCTGCGGCTTATTCCTCCGCTATGTTTGTTTTGGGCAAT
Transcript >Ophio5|4095
ATGGCGCCAACCCTGCAACTCCCCGATCAGTATGGGCTTGTGCTCGCCGCCGCCACGAGCACCTTCTTCGTCAAC
ACTCTCCACGCTTTCCGTACCATAAAGTTTCGCAAGGCCAGCGGAATCGAGTATCCTCAAGCCTATGCAACCAAC
GAGCAGGCGGCTAAGAATGAGAGTGCCTACCGTTTCAACTGCGCTCAGCGAGCTCATCATAACTTCACCGAAAAC
CACACATCCCTTCTCGGTGCCCTCCTTATTGCTGGCATTCGGTTCCCTGTTCCCGCCGCCGCCGTCGGAGCCGGC
TGGAGTCTGTCCAGAGTCCTGTACCTTCTCGGCTACACCAGCTCCGCCGGCCCTCGCGGCCGCCTAATCGGCGGG
CTTGGCGGCACCTTGAGTGACTTGCTCCTCAAACTCGCTGCGGCTTATTCCTCCGCTATGTTTGTTTTGGGCAAT
TAG
Gene >Ophio5|4095
ATGGCGCCAACCCTGCAACTCCCCGATCAGTATGGGTCAGTGAGAGAGCATCAAACACGCGACGCTCAGCGCCGG
CTAACTCTGCGTCTGCAGGCTTGTGCTCGCCGCCGCCACGAGCACCTTCTTCGTCAACACTCTCCACGCTTTCCG
TACCATAAAGTTTCGCAAGGCCAGCGGAATCGAGTATCCTCAAGCCTATGCAACCAACGAGCAGGCGGCTAAGAA
TGAGAGTGCCTACCGTTTCAACTGCGGTGTGTTTTGCCCGTGCTCCCATCCGTTCGAGTCACCGGCCTTGCTGAA
AATTCACTAGCTCAGCGAGCTCATCATAACTTCACCGAAAACCACACATCCCTTCTCGGTGCCCTCCTTATTGCT
GGCATTCGGTTCCCTGTTCCCGCCGCCGCCGTCGGAGCCGGCTGGAGTCTGTCCAGAGTCCTGTACCTTCTCGGC
TACACCAGCTCCGCCGGCCCTCGCGGCCGCCTAATGTTTGTCTTTTTCACCTCTTCTCAGAGACGACCCGAGCTG
ACGCATCTTGTGTTCCGCAGCGGCGGGCTTGGCGGCACCTTGAGTGACTTGCTCCTCAAACTCGCTGCGGCTTAT
TCCTCCGCTATGTTTGTTTTGGGCAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail