Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4084
Gene name
Locationscaffold_32:38283..39997
Strand+
Gene length (bp)1714
Transcript length (bp)1644
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.7E-49 105 520

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 113 524 5.0E-29
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 31 501 3.0E-26
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 113 524 6.0E-25
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 108 524 8.0E-25
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 113 524 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 113 524 5.0E-29
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 31 501 3.0E-26
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 113 524 6.0E-25
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 108 524 8.0E-25
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 113 524 2.0E-24
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 113 524 4.0E-24
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 113 524 5.0E-24
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 121 524 6.0E-24
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 115 501 7.0E-24
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 116 518 7.0E-24
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 115 524 7.0E-24
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 113 524 9.0E-24
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 113 524 2.0E-23
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 113 524 3.0E-23
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 113 524 6.0E-23
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 113 501 6.0E-23
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 113 501 2.0E-22
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 63 521 2.0E-22
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 147 531 4.0E-22
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 63 521 5.0E-22
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 115 521 9.0E-22
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 113 501 1.0E-21
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 113 520 2.0E-21
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 39 510 4.0E-21
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 113 524 4.0E-21
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 113 501 5.0E-21
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 113 501 5.0E-21
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 98 524 8.0E-21
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 43 543 1.0E-20
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 113 513 2.0E-20
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 322 518 3.0E-20
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 111 518 3.0E-20
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 107 535 1.0E-19
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 102 520 1.0E-19
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 110 518 2.0E-19
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 309 518 2.0E-19
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 1 518 2.0E-19
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 110 524 2.0E-19
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 61 543 3.0E-19
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 112 518 3.0E-19
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 123 525 3.0E-19
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 107 521 7.0E-19
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 213 510 8.0E-19
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 107 511 1.0E-18
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 112 518 2.0E-18
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 113 505 2.0E-18
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 112 521 2.0E-18
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 112 543 2.0E-18
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 112 543 2.0E-18
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 110 510 3.0E-18
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 88 510 3.0E-18
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 123 525 4.0E-18
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 112 521 7.0E-18
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 112 524 9.0E-18
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 145 535 1.0E-17
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 113 543 1.0E-17
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 115 521 2.0E-17
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 330 510 2.0E-17
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 330 510 2.0E-17
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 113 521 2.0E-17
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 52 543 4.0E-17
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 61 544 4.0E-17
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 113 517 4.0E-17
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 312 518 9.0E-17
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 318 510 1.0E-16
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 330 510 1.0E-16
sp|Q9VGB4|CP132_DROME Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 104 500 2.0E-16
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 105 521 2.0E-16
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 112 521 2.0E-16
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 107 517 5.0E-16
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 109 517 6.0E-16
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 268 499 6.0E-16
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 40 510 1.0E-15
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 110 525 1.0E-15
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 62 534 2.0E-15
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 113 521 2.0E-15
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 112 521 2.0E-15
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 72 524 3.0E-15
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 322 545 3.0E-15
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 112 528 4.0E-15
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 325 524 4.0E-15
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 149 510 4.0E-15
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 40 510 4.0E-15
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 112 521 5.0E-15
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 149 510 7.0E-15
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 149 510 8.0E-15
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 95 510 9.0E-15
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 103 517 1.0E-14
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 333 517 1.0E-14
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 113 501 1.0E-14
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 61 518 2.0E-14
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 113 543 2.0E-14
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 155 519 3.0E-14
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 113 521 4.0E-14
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 318 510 4.0E-14
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 113 510 4.0E-14
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 146 510 4.0E-14
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 312 523 4.0E-14
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 107 524 4.0E-14
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 108 524 4.0E-14
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 115 518 5.0E-14
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 115 511 5.0E-14
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 107 521 6.0E-14
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 142 518 8.0E-14
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 107 521 9.0E-14
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 318 547 1.0E-13
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 318 547 1.0E-13
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 114 511 1.0E-13
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 35 522 1.0E-13
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 307 546 1.0E-13
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 61 518 1.0E-13
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 98 510 1.0E-13
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 268 521 1.0E-13
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 65 517 2.0E-13
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 140 518 2.0E-13
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 131 520 2.0E-13
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 381 528 2.0E-13
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 104 523 3.0E-13
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 113 537 3.0E-13
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 330 505 3.0E-13
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 317 517 4.0E-13
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 322 495 4.0E-13
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 156 510 5.0E-13
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 197 505 5.0E-13
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 105 524 6.0E-13
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 314 520 8.0E-13
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 61 517 8.0E-13
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 319 520 8.0E-13
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 71 520 9.0E-13
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 332 517 9.0E-13
sp|Q9V4T3|C4AD1_DROME Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 56 517 9.0E-13
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 140 517 1.0E-12
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 315 532 1.0E-12
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 62 510 1.0E-12
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 155 510 1.0E-12
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 71 520 1.0E-12
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 113 523 1.0E-12
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 312 518 1.0E-12
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 113 524 1.0E-12
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 292 518 1.0E-12
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 317 521 1.0E-12
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 330 510 1.0E-12
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 318 521 1.0E-12
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 114 511 2.0E-12
sp|Q7XHW5|C14B1_ORYSJ Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 315 523 2.0E-12
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 61 518 2.0E-12
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 115 510 2.0E-12
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 381 512 2.0E-12
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 61 519 3.0E-12
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 284 517 3.0E-12
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 318 518 4.0E-12
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 324 517 4.0E-12
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 118 511 4.0E-12
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 112 522 4.0E-12
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 317 521 5.0E-12
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 108 516 5.0E-12
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 317 529 5.0E-12
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 330 527 6.0E-12
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 326 524 6.0E-12
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 114 511 6.0E-12
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 318 518 6.0E-12
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 321 521 7.0E-12
sp|Q7KWN2|C525A_DICDI Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 202 522 7.0E-12
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 114 521 7.0E-12
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 162 526 8.0E-12
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 109 499 8.0E-12
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 111 521 9.0E-12
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 61 518 1.0E-11
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 315 518 1.0E-11
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 61 519 1.0E-11
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 184 532 1.0E-11
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 58 519 1.0E-11
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 316 517 1.0E-11
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 333 477 1.0E-11
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 184 528 1.0E-11
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 290 524 1.0E-11
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 313 499 2.0E-11
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 61 518 2.0E-11
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 108 522 2.0E-11
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 317 534 2.0E-11
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 382 522 2.0E-11
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 352 523 2.0E-11
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 324 517 2.0E-11
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 323 520 2.0E-11
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 35 526 2.0E-11
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 323 520 2.0E-11
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 314 511 3.0E-11
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 61 518 3.0E-11
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 330 512 3.0E-11
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 105 528 3.0E-11
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 317 545 4.0E-11
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 330 519 4.0E-11
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 299 524 4.0E-11
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 332 509 5.0E-11
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 333 510 6.0E-11
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 159 509 6.0E-11
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 308 505 6.0E-11
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 323 474 6.0E-11
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 61 519 6.0E-11
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 330 522 6.0E-11
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 102 522 6.0E-11
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 157 545 7.0E-11
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 155 520 7.0E-11
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 322 524 7.0E-11
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 320 521 8.0E-11
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 182 509 8.0E-11
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 318 521 9.0E-11
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 318 518 9.0E-11
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 201 528 9.0E-11
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 318 518 1.0E-10
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 320 505 1.0E-10
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 323 520 1.0E-10
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 317 510 1.0E-10
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 315 532 1.0E-10
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 196 517 1.0E-10
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 322 495 1.0E-10
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 321 521 1.0E-10
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 333 477 1.0E-10
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 323 520 1.0E-10
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 310 528 1.0E-10
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 330 535 2.0E-10
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 326 524 2.0E-10
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 316 518 2.0E-10
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 320 517 2.0E-10
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 318 518 2.0E-10
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 102 522 2.0E-10
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 317 509 2.0E-10
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 332 520 2.0E-10
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 330 545 2.0E-10
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 105 472 3.0E-10
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 315 532 3.0E-10
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 312 520 3.0E-10
sp|Q42569|C90A1_ARATH Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 316 509 3.0E-10
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 308 505 4.0E-10
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 318 518 4.0E-10
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 309 518 4.0E-10
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 114 511 4.0E-10
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 314 522 5.0E-10
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 326 529 5.0E-10
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 318 518 5.0E-10
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 315 518 5.0E-10
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 377 522 6.0E-10
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 145 518 6.0E-10
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 308 515 6.0E-10
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 314 522 6.0E-10
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 102 528 6.0E-10
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 315 519 6.0E-10
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 114 521 6.0E-10
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 145 522 7.0E-10
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 292 526 7.0E-10
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 58 520 7.0E-10
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 320 517 8.0E-10
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 320 510 8.0E-10
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 325 509 8.0E-10
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 159 509 8.0E-10
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 271 524 8.0E-10
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 326 520 1.0E-09
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 133 517 1.0E-09
sp|Q5UQ90|YL532_MIMIV Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 314 525 1.0E-09
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 140 518 1.0E-09
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 341 509 1.0E-09
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 322 518 1.0E-09
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 323 520 1.0E-09
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 149 522 1.0E-09
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 317 520 1.0E-09
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 323 520 2.0E-09
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 326 521 2.0E-09
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 292 526 2.0E-09
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 330 501 2.0E-09
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 321 525 2.0E-09
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 317 522 2.0E-09
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 379 528 2.0E-09
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 321 517 2.0E-09
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 322 510 2.0E-09
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 341 509 3.0E-09
sp|Q50EK6|C72B1_PINTA Abietadienol/abietadienal oxidase OS=Pinus taeda GN=CYP720B1 PE=1 SV=1 314 523 3.0E-09
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 273 516 3.0E-09
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 321 510 3.0E-09
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 326 513 3.0E-09
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 317 518 3.0E-09
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 108 508 4.0E-09
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 381 529 4.0E-09
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 133 518 4.0E-09
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 381 511 5.0E-09
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 321 506 5.0E-09
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 110 508 5.0E-09
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 321 510 5.0E-09
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 113 528 5.0E-09
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 312 525 6.0E-09
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 314 520 7.0E-09
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 318 517 7.0E-09
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 320 517 7.0E-09
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 155 502 8.0E-09
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 317 518 8.0E-09
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 314 520 9.0E-09
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 317 522 9.0E-09
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 97 528 1.0E-08
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 307 509 1.0E-08
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 314 520 1.0E-08
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 330 532 1.0E-08
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 381 510 1.0E-08
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 322 508 1.0E-08
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 323 510 1.0E-08
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 352 510 1.0E-08
sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 352 532 1.0E-08
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 330 528 2.0E-08
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 320 506 2.0E-08
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 99 510 2.0E-08
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 326 495 2.0E-08
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 314 520 2.0E-08
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 381 518 2.0E-08
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 340 513 2.0E-08
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 317 510 2.0E-08
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 330 521 2.0E-08
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 317 541 2.0E-08
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 326 495 2.0E-08
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 308 543 2.0E-08
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 326 528 2.0E-08
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 382 531 3.0E-08
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 318 472 3.0E-08
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 319 497 3.0E-08
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 320 510 3.0E-08
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 332 514 4.0E-08
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 381 510 4.0E-08
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 184 528 4.0E-08
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 381 518 4.0E-08
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 313 501 4.0E-08
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 330 521 4.0E-08
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 317 521 4.0E-08
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 330 517 4.0E-08
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 314 520 4.0E-08
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 330 521 5.0E-08
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 324 525 5.0E-08
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 317 518 5.0E-08
sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 314 510 6.0E-08
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 326 522 7.0E-08
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 314 501 7.0E-08
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 317 510 8.0E-08
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 317 520 8.0E-08
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 314 522 8.0E-08
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 382 522 8.0E-08
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 336 510 8.0E-08
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 317 520 9.0E-08
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 314 526 9.0E-08
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 319 521 1.0E-07
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 240 472 1.0E-07
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 319 537 1.0E-07
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 308 479 1.0E-07
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 381 528 1.0E-07
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 321 510 1.0E-07
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 325 522 1.0E-07
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 318 511 1.0E-07
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 317 520 1.0E-07
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 312 489 1.0E-07
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 317 505 1.0E-07
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 318 512 1.0E-07
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 272 472 1.0E-07
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 292 510 2.0E-07
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 330 477 2.0E-07
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 317 472 2.0E-07
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 318 495 2.0E-07
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 381 510 2.0E-07
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 317 509 2.0E-07
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 318 509 2.0E-07
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 320 506 2.0E-07
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 108 510 3.0E-07
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 317 453 3.0E-07
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 318 513 3.0E-07
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 314 477 3.0E-07
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 314 530 3.0E-07
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 377 532 4.0E-07
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 381 511 4.0E-07
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 312 519 4.0E-07
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 317 511 4.0E-07
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 318 509 5.0E-07
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 325 510 5.0E-07
sp|Q54FP9|C5144_DICDI Probable cytochrome P450 514A4 OS=Dictyostelium discoideum GN=cyp514A4 PE=3 SV=1 326 489 5.0E-07
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 110 504 5.0E-07
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 313 472 5.0E-07
sp|P10633|CP2D1_RAT Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 314 520 6.0E-07
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 320 501 6.0E-07
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 318 517 7.0E-07
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 317 474 7.0E-07
sp|Q9LXM3|C71BZ_ARATH Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2 326 513 7.0E-07
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 314 483 8.0E-07
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 315 472 9.0E-07
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 381 511 9.0E-07
sp|P93703|C71C3_MAIZE Cytochrome P450 71C3 OS=Zea mays GN=CYP71C3 PE=2 SV=1 73 523 1.0E-06
sp|O65785|C71B3_ARATH Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 305 523 1.0E-06
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 320 517 1.0E-06
sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 112 510 1.0E-06
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 341 499 1.0E-06
sp|Q54FM9|C5141_DICDI Probable cytochrome P450 514A1 OS=Dictyostelium discoideum GN=cyp514A1 PE=3 SV=1 326 452 2.0E-06
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 307 525 2.0E-06
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 318 509 2.0E-06
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 113 501 2.0E-06
sp|Q9DBX6|CP2S1_MOUSE Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 317 505 2.0E-06
sp|P79760|CP1A4_CHICK Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 318 521 2.0E-06
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 381 453 2.0E-06
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 319 532 2.0E-06
sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 272 522 2.0E-06
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 323 472 2.0E-06
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 314 520 3.0E-06
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 314 483 3.0E-06
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 254 453 3.0E-06
sp|Q02315|CP51_PICKU Lanosterol 14-alpha demethylase (Fragment) OS=Pichia kudriavzevii GN=CYP51 PE=3 SV=1 318 495 3.0E-06
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 330 522 4.0E-06
sp|O14442|CP51_UNCNE Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 319 511 4.0E-06
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 290 532 4.0E-06
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 272 522 4.0E-06
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 341 499 5.0E-06
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 314 453 6.0E-06
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 313 520 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.83 0.0 1.70
CcL In ants, during behavior modification 0.47 0.0 1.05
CcD In ants, recently dead 0.19 0.0 0.55

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4084
MAIPWRQMTAAAVAGDACLLLMLQVRSREVLVETFAILWLMQLVAWGIWHMYLYPHYASPLRHLPQPKDGHWLYG
HRSGLHPGDIGVDARKWVNSIKHDNFIRYLDFFNSETLLVTSPRAISDILVSNNYNFPRSFVSRNLVGRYTGYGI
GVAMGDEHKAQRRKLIPAFSLKVIRPLYPVFWAKGEETVMAMTAAAESSNSIIDIHSWALRCAIDVIGIASMGVD
FGAVLDDNPPLPRAYEQLTAGSWQDGLLLLLEMVVSKETVSRLPLRRSREIDESLTLIHAACHGGIRITKKALEA
GTLTRPNICSVGLEAGFSDELMVEQLTTALFGGQHAISKTLTAAVYSLSCFPEKQQRLRDELRSHLPQFYRSDSC
HRPSYADIDGLPYLEAVVKEVLRKHGTGTSSREAKCDVIVQGVHIPRGTAIKLATHATSVDPELWGEDAAEFRPE
RWLVAAAAAANDDSGVANGAGRDAKIGGASSNYAFLPFMHGPQQCIAARFAQAEVACLLAAWFGRLEFGLADEAL
RDEGRLGRRPMESEMLVRVRAV
Coding >Ophio5|4084
ATGGCTATCCCATGGCGTCAGATGACGGCCGCTGCAGTGGCCGGCGATGCGTGTCTCCTGTTGATGCTCCAGGTC
CGGTCCAGAGAGGTTCTCGTCGAGACCTTTGCTATCCTCTGGCTGATGCAGCTCGTTGCTTGGGGCATCTGGCAC
ATGTACCTTTACCCGCATTACGCGTCGCCGCTGCGACATCTGCCTCAGCCCAAGGATGGCCACTGGTTGTATGGC
CATCGCAGCGGATTACATCCGGGCGACATTGGCGTCGACGCGAGGAAGTGGGTAAACTCCATCAAGCACGACAAC
TTCATCCGCTATCTCGACTTTTTCAATAGTGAGACGCTGCTCGTCACGTCTCCCCGGGCCATCTCCGACATCCTC
GTGTCCAACAACTACAACTTCCCCAGGTCCTTCGTCTCACGGAACCTGGTCGGCCGCTACACTGGCTACGGAATC
GGCGTTGCCATGGGAGACGAGCACAAGGCGCAGAGACGGAAGCTGATCCCGGCTTTCTCCTTGAAAGTCATCAGG
CCGCTGTATCCAGTCTTCTGGGCCAAGGGCGAGGAGACGGTCATGGCCATGACGGCGGCGGCGGAATCCAGCAAT
TCCATCATCGATATTCATTCTTGGGCACTGCGGTGTGCTATCGACGTCATTGGCATCGCAAGTATGGGTGTCGAC
TTTGGAGCCGTTCTCGACGACAACCCTCCCTTGCCTCGGGCATATGAGCAGCTGACGGCCGGCTCATGGCAGGAT
GGTCTGCTTCTTCTGCTCGAAATGGTCGTGTCGAAGGAGACCGTCTCTCGGCTTCCGCTGAGACGCAGCAGAGAG
ATTGACGAGTCTCTGACGCTGATCCACGCGGCCTGTCATGGAGGCATCCGCATCACCAAGAAGGCCTTGGAGGCT
GGAACGCTCACGCGACCCAACATCTGCTCAGTCGGGCTCGAGGCCGGCTTCAGCGACGAGCTAATGGTGGAGCAG
CTAACGACGGCGCTGTTCGGAGGCCAGCACGCCATCTCCAAAACGCTGACGGCTGCCGTTTATTCGCTGTCGTGT
TTCCCGGAGAAGCAGCAGCGTCTACGCGATGAGCTACGAAGTCATCTCCCACAATTCTATCGCTCTGACAGCTGC
CATCGGCCATCGTACGCTGACATTGACGGTTTACCGTACCTTGAAGCCGTGGTAAAAGAGGTTCTACGTAAACAT
GGCACCGGCACGTCATCAAGAGAAGCCAAATGCGACGTCATCGTCCAGGGAGTGCATATCCCGCGCGGAACAGCC
ATCAAGCTTGCCACGCATGCGACGAGTGTCGATCCGGAGCTATGGGGCGAAGACGCAGCTGAATTTCGACCGGAA
CGCTGGTTAGTAGCAGCAGCAGCAGCGGCCAACGACGACTCTGGAGTAGCGAACGGAGCCGGAAGAGATGCCAAG
ATTGGCGGGGCGAGCAGCAACTACGCCTTCTTACCCTTTATGCATGGCCCGCAGCAGTGTATTGCGGCGCGGTTC
GCGCAGGCTGAGGTGGCTTGCTTGCTGGCTGCTTGGTTTGGTCGGCTGGAGTTTGGGCTTGCGGATGAGGCGTTG
AGGGATGAGGGGAGGCTGGGGAGGAGGCCGATGGAGTCGGAGATGTTGGTGAGGGTCAGGGCTGTT
Transcript >Ophio5|4084
ATGGCTATCCCATGGCGTCAGATGACGGCCGCTGCAGTGGCCGGCGATGCGTGTCTCCTGTTGATGCTCCAGGTC
CGGTCCAGAGAGGTTCTCGTCGAGACCTTTGCTATCCTCTGGCTGATGCAGCTCGTTGCTTGGGGCATCTGGCAC
ATGTACCTTTACCCGCATTACGCGTCGCCGCTGCGACATCTGCCTCAGCCCAAGGATGGCCACTGGTTGTATGGC
CATCGCAGCGGATTACATCCGGGCGACATTGGCGTCGACGCGAGGAAGTGGGTAAACTCCATCAAGCACGACAAC
TTCATCCGCTATCTCGACTTTTTCAATAGTGAGACGCTGCTCGTCACGTCTCCCCGGGCCATCTCCGACATCCTC
GTGTCCAACAACTACAACTTCCCCAGGTCCTTCGTCTCACGGAACCTGGTCGGCCGCTACACTGGCTACGGAATC
GGCGTTGCCATGGGAGACGAGCACAAGGCGCAGAGACGGAAGCTGATCCCGGCTTTCTCCTTGAAAGTCATCAGG
CCGCTGTATCCAGTCTTCTGGGCCAAGGGCGAGGAGACGGTCATGGCCATGACGGCGGCGGCGGAATCCAGCAAT
TCCATCATCGATATTCATTCTTGGGCACTGCGGTGTGCTATCGACGTCATTGGCATCGCAAGTATGGGTGTCGAC
TTTGGAGCCGTTCTCGACGACAACCCTCCCTTGCCTCGGGCATATGAGCAGCTGACGGCCGGCTCATGGCAGGAT
GGTCTGCTTCTTCTGCTCGAAATGGTCGTGTCGAAGGAGACCGTCTCTCGGCTTCCGCTGAGACGCAGCAGAGAG
ATTGACGAGTCTCTGACGCTGATCCACGCGGCCTGTCATGGAGGCATCCGCATCACCAAGAAGGCCTTGGAGGCT
GGAACGCTCACGCGACCCAACATCTGCTCAGTCGGGCTCGAGGCCGGCTTCAGCGACGAGCTAATGGTGGAGCAG
CTAACGACGGCGCTGTTCGGAGGCCAGCACGCCATCTCCAAAACGCTGACGGCTGCCGTTTATTCGCTGTCGTGT
TTCCCGGAGAAGCAGCAGCGTCTACGCGATGAGCTACGAAGTCATCTCCCACAATTCTATCGCTCTGACAGCTGC
CATCGGCCATCGTACGCTGACATTGACGGTTTACCGTACCTTGAAGCCGTGGTAAAAGAGGTTCTACGTAAACAT
GGCACCGGCACGTCATCAAGAGAAGCCAAATGCGACGTCATCGTCCAGGGAGTGCATATCCCGCGCGGAACAGCC
ATCAAGCTTGCCACGCATGCGACGAGTGTCGATCCGGAGCTATGGGGCGAAGACGCAGCTGAATTTCGACCGGAA
CGCTGGTTAGTAGCAGCAGCAGCAGCGGCCAACGACGACTCTGGAGTAGCGAACGGAGCCGGAAGAGATGCCAAG
ATTGGCGGGGCGAGCAGCAACTACGCCTTCTTACCCTTTATGCATGGCCCGCAGCAGTGTATTGCGGCGCGGTTC
GCGCAGGCTGAGGTGGCTTGCTTGCTGGCTGCTTGGTTTGGTCGGCTGGAGTTTGGGCTTGCGGATGAGGCGTTG
AGGGATGAGGGGAGGCTGGGGAGGAGGCCGATGGAGTCGGAGATGTTGGTGAGGGTCAGGGCTGTTTGA
Gene >Ophio5|4084
ATGGCTATCCCATGGCGTCAGATGACGGCCGCTGCAGTGGCCGGCGATGCGTGTCTCCTGTTGATGCTCCAGGTC
CGGTCCAGAGAGGTTCTCGTCGAGACCTTTGCTATCCTCTGGCTGATGCAGCTCGTTGCTTGGGGCATCTGGCAC
ATGTACCTTTACCCGCATTACGCGTCGCCGCTGCGACATCTGCCTCAGCCCAAGGATGGCCACTGGTTGTATGGC
CATCGCAGCGGATTACATCCGGGCGACATTGGCGTCGACGCGAGGAAGTGGTGAGTTTCTCCCCACCCCCCCCCC
TGTAGCCGTTTAGAGCGGCCAAGTTGGTTGATGCTTCGTCAACAGGGTAAACTCCATCAAGCACGACAACTTCAT
CCGCTATCTCGACTTTTTCAATAGTGAGACGCTGCTCGTCACGTCTCCCCGGGCCATCTCCGACATCCTCGTGTC
CAACAACTACAACTTCCCCAGGTCCTTCGTCTCACGGAACCTGGTCGGCCGCTACACTGGCTACGGAATCGGCGT
TGCCATGGGAGACGAGCACAAGGCGCAGAGACGGAAGCTGATCCCGGCTTTCTCCTTGAAAGTCATCAGGCCGCT
GTATCCAGTCTTCTGGGCCAAGGGCGAGGAGACGGTCATGGCCATGACGGCGGCGGCGGAATCCAGCAATTCCAT
CATCGATATTCATTCTTGGGCACTGCGGTGTGCTATCGACGTCATTGGCATCGCAAGTATGGGTGTCGACTTTGG
AGCCGTTCTCGACGACAACCCTCCCTTGCCTCGGGCATATGAGCAGCTGACGGCCGGCTCATGGCAGGATGGTCT
GCTTCTTCTGCTCGAAATGGTCGTGTCGAAGGAGACCGTCTCTCGGCTTCCGCTGAGACGCAGCAGAGAGATTGA
CGAGTCTCTGACGCTGATCCACGCGGCCTGTCATGGAGGCATCCGCATCACCAAGAAGGCCTTGGAGGCTGGAAC
GCTCACGCGACCCAACATCTGCTCAGTCGGGCTCGAGGCCGGCTTCAGCGACGAGCTAATGGTGGAGCAGCTAAC
GACGGCGCTGTTCGGAGGCCAGCACGCCATCTCCAAAACGCTGACGGCTGCCGTTTATTCGCTGTCGTGTTTCCC
GGAGAAGCAGCAGCGTCTACGCGATGAGCTACGAAGTCATCTCCCACAATTCTATCGCTCTGACAGCTGCCATCG
GCCATCGTACGCTGACATTGACGGTTTACCGTACCTTGAAGCCGTGGTAAAAGAGGTTCTACGTAAACATGGCAC
CGGCACGTCATCAAGAGAAGCCAAATGCGACGTCATCGTCCAGGGAGTGCATATCCCGCGCGGAACAGCCATCAA
GCTTGCCACGCATGCGACGAGTGTCGATCCGGAGCTATGGGGCGAAGACGCAGCTGAATTTCGACCGGAACGCTG
GTTAGTAGCAGCAGCAGCAGCGGCCAACGACGACTCTGGAGTAGCGAACGGAGCCGGAAGAGATGCCAAGATTGG
CGGGGCGAGCAGCAACTACGCCTTCTTACCCTTTATGCATGGCCCGCAGCAGTGTATTGCGGCGCGGTTCGCGCA
GGCTGAGGTGGCTTGCTTGCTGGCTGCTTGGTTTGGTCGGCTGGAGTTTGGGCTTGCGGATGAGGCGTTGAGGGA
TGAGGGGAGGCTGGGGAGGAGGCCGATGGAGTCGGAGATGTTGGTGAGGGTCAGGGCTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail