Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4082
Gene name
Locationscaffold_32:28066..28987
Strand+
Gene length (bp)921
Transcript length (bp)858
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03959 FSH1 Serine hydrolase (FSH1) 1.4E-22 2 265

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q503Y4|OVCA2_DANRE Ovarian cancer-associated gene 2 protein homolog OS=Danio rerio GN=ovca2 PE=2 SV=1 1 124 9.0E-11
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 2 124 4.0E-10
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 124 5.0E-09
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 124 1.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6237 0.415 0.3791 0.0537 0.2639 0.0066 0.0826 0.0885 0.1339 0.0807

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 14 (None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6098
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00024
Ophiocordyceps camponoti-floridani Ophcf2|00025
Ophiocordyceps camponoti-rufipedis Ophun1|5086
Ophiocordyceps kimflemingae Ophio5|4082 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4082
MRILCVHGAAINGEIFAAKTEKLRSLLPAEYSYDWPDGDHQATPTKDLSDAYPGPYLTHIEDITTLGIRKSIERL
EACIEEDGPFDGVMAICEGAMLTASLLFKRQMENPTGPLPFRFAIFIAGSPPFTWTDSIGQNLFDQLISDDPFNL
DKDKFEPDEKSDCKPNVERIKDFGQKVYRDLTPELGKWVQLVEEMGTGNREKAHLMPHALLPQLHPDRLDLPTAH
MWGRKDVLSSHSRLLFRLCCPELALSYVHQGAHDIPQSWSDNEAFGDLVRKMILRSQFAL
Coding >Ophio5|4082
ATGCGCATCCTCTGCGTCCACGGAGCCGCAATCAACGGCGAGATATTCGCTGCCAAGACGGAAAAGCTCCGATCT
CTTCTGCCGGCCGAGTATTCGTACGACTGGCCCGATGGCGATCACCAGGCCACGCCCACCAAAGATCTCTCGGAT
GCTTACCCAGGACCATATCTGACGCACATCGAGGACATCACCACACTCGGCATCCGGAAATCCATCGAGAGACTC
GAGGCCTGTATCGAAGAGGATGGTCCGTTTGACGGCGTCATGGCAATCTGCGAGGGGGCCATGCTCACCGCATCT
CTGCTCTTCAAGCGGCAGATGGAGAACCCAACAGGACCGCTTCCCTTCCGGTTCGCCATCTTCATAGCCGGCTCA
CCTCCCTTTACGTGGACCGACTCCATCGGACAGAACCTGTTCGACCAACTCATCAGCGACGACCCCTTCAACTTG
GACAAGGACAAGTTCGAGCCTGACGAAAAGAGCGACTGCAAGCCCAACGTGGAGCGCATCAAAGACTTTGGCCAA
AAGGTATACAGGGACCTGACTCCAGAGCTGGGCAAATGGGTCCAGCTCGTCGAAGAGATGGGCACCGGCAACCGG
GAAAAGGCTCATCTCATGCCGCACGCTCTACTGCCCCAGCTGCACCCAGACAGACTCGATCTGCCGACGGCCCAT
ATGTGGGGACGAAAGGACGTCTTGAGCAGCCATTCCAGACTCCTGTTTCGGTTGTGCTGCCCGGAACTGGCGCTG
AGTTATGTGCACCAGGGGGCACACGATATTCCGCAGTCGTGGTCGGACAATGAGGCTTTTGGTGACTTGGTTCGG
AAGATGATCCTTCGCAGCCAGTTTGCTCTG
Transcript >Ophio5|4082
ATGCGCATCCTCTGCGTCCACGGAGCCGCAATCAACGGCGAGATATTCGCTGCCAAGACGGAAAAGCTCCGATCT
CTTCTGCCGGCCGAGTATTCGTACGACTGGCCCGATGGCGATCACCAGGCCACGCCCACCAAAGATCTCTCGGAT
GCTTACCCAGGACCATATCTGACGCACATCGAGGACATCACCACACTCGGCATCCGGAAATCCATCGAGAGACTC
GAGGCCTGTATCGAAGAGGATGGTCCGTTTGACGGCGTCATGGCAATCTGCGAGGGGGCCATGCTCACCGCATCT
CTGCTCTTCAAGCGGCAGATGGAGAACCCAACAGGACCGCTTCCCTTCCGGTTCGCCATCTTCATAGCCGGCTCA
CCTCCCTTTACGTGGACCGACTCCATCGGACAGAACCTGTTCGACCAACTCATCAGCGACGACCCCTTCAACTTG
GACAAGGACAAGTTCGAGCCTGACGAAAAGAGCGACTGCAAGCCCAACGTGGAGCGCATCAAAGACTTTGGCCAA
AAGGTATACAGGGACCTGACTCCAGAGCTGGGCAAATGGGTCCAGCTCGTCGAAGAGATGGGCACCGGCAACCGG
GAAAAGGCTCATCTCATGCCGCACGCTCTACTGCCCCAGCTGCACCCAGACAGACTCGATCTGCCGACGGCCCAT
ATGTGGGGACGAAAGGACGTCTTGAGCAGCCATTCCAGACTCCTGTTTCGGTTGTGCTGCCCGGAACTGGCGCTG
AGTTATGTGCACCAGGGGGCACACGATATTCCGCAGTCGTGGTCGGACAATGAGGCTTTTGGTGACTTGGTTCGG
AAGATGATCCTTCGCAGCCAGTTTGCTCTGTAG
Gene >Ophio5|4082
ATGCGCATCCTCTGCGTCCACGGAGCCGCAATCAACGGCGAGATATTCGCTGCCAAGACGGAAAAGCTCCGATCT
CTTCTGCCGGCCGAGTATTCGTACGACTGGCCCGATGGCGATCACCAGGCCACGCCCACCAAAGATCTCTCGGAT
GCTTACCCAGGACCATATCTGACGCACATCGAGGACATCACCACACTCGGCATCCGGAAATCCATCGAGAGACTC
GAGGCCTGTATCGAAGAGGATGGTCCGTTTGACGGCGTCATGGCAATCTGCGAGGTGCCTCTCCTACAGCTCTGT
TCCCATCCGAGAGGGCAAAAACAAAACTGACGCGTCAATCAGGGGGCCATGCTCACCGCATCTCTGCTCTTCAAG
CGGCAGATGGAGAACCCAACAGGACCGCTTCCCTTCCGGTTCGCCATCTTCATAGCCGGCTCACCTCCCTTTACG
TGGACCGACTCCATCGGACAGAACCTGTTCGACCAACTCATCAGCGACGACCCCTTCAACTTGGACAAGGACAAG
TTCGAGCCTGACGAAAAGAGCGACTGCAAGCCCAACGTGGAGCGCATCAAAGACTTTGGCCAAAAGGTATACAGG
GACCTGACTCCAGAGCTGGGCAAATGGGTCCAGCTCGTCGAAGAGATGGGCACCGGCAACCGGGAAAAGGCTCAT
CTCATGCCGCACGCTCTACTGCCCCAGCTGCACCCAGACAGACTCGATCTGCCGACGGCCCATATGTGGGGACGA
AAGGACGTCTTGAGCAGCCATTCCAGACTCCTGTTTCGGTTGTGCTGCCCGGAACTGGCGCTGAGTTATGTGCAC
CAGGGGGCACACGATATTCCGCAGTCGTGGTCGGACAATGAGGCTTTTGGTGACTTGGTTCGGAAGATGATCCTT
CGCAGCCAGTTTGCTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail