Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4082
Gene name
Locationscaffold_32:28066..28987
Strand+
Gene length (bp)921
Transcript length (bp)858
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03959 FSH1 Serine hydrolase (FSH1) 1.4E-22 2 265

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q503Y4|OVCA2_DANRE Ovarian cancer-associated gene 2 protein homolog OS=Danio rerio GN=ovca2 PE=2 SV=1 1 124 9.0E-11
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 2 124 4.0E-10
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 124 5.0E-09
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 124 1.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4082
MRILCVHGAAINGEIFAAKTEKLRSLLPAEYSYDWPDGDHQATPTKDLSDAYPGPYLTHIEDITTLGIRKSIERL
EACIEEDGPFDGVMAICEGAMLTASLLFKRQMENPTGPLPFRFAIFIAGSPPFTWTDSIGQNLFDQLISDDPFNL
DKDKFEPDEKSDCKPNVERIKDFGQKVYRDLTPELGKWVQLVEEMGTGNREKAHLMPHALLPQLHPDRLDLPTAH
MWGRKDVLSSHSRLLFRLCCPELALSYVHQGAHDIPQSWSDNEAFGDLVRKMILRSQFAL
Coding >Ophio5|4082
ATGCGCATCCTCTGCGTCCACGGAGCCGCAATCAACGGCGAGATATTCGCTGCCAAGACGGAAAAGCTCCGATCT
CTTCTGCCGGCCGAGTATTCGTACGACTGGCCCGATGGCGATCACCAGGCCACGCCCACCAAAGATCTCTCGGAT
GCTTACCCAGGACCATATCTGACGCACATCGAGGACATCACCACACTCGGCATCCGGAAATCCATCGAGAGACTC
GAGGCCTGTATCGAAGAGGATGGTCCGTTTGACGGCGTCATGGCAATCTGCGAGGGGGCCATGCTCACCGCATCT
CTGCTCTTCAAGCGGCAGATGGAGAACCCAACAGGACCGCTTCCCTTCCGGTTCGCCATCTTCATAGCCGGCTCA
CCTCCCTTTACGTGGACCGACTCCATCGGACAGAACCTGTTCGACCAACTCATCAGCGACGACCCCTTCAACTTG
GACAAGGACAAGTTCGAGCCTGACGAAAAGAGCGACTGCAAGCCCAACGTGGAGCGCATCAAAGACTTTGGCCAA
AAGGTATACAGGGACCTGACTCCAGAGCTGGGCAAATGGGTCCAGCTCGTCGAAGAGATGGGCACCGGCAACCGG
GAAAAGGCTCATCTCATGCCGCACGCTCTACTGCCCCAGCTGCACCCAGACAGACTCGATCTGCCGACGGCCCAT
ATGTGGGGACGAAAGGACGTCTTGAGCAGCCATTCCAGACTCCTGTTTCGGTTGTGCTGCCCGGAACTGGCGCTG
AGTTATGTGCACCAGGGGGCACACGATATTCCGCAGTCGTGGTCGGACAATGAGGCTTTTGGTGACTTGGTTCGG
AAGATGATCCTTCGCAGCCAGTTTGCTCTG
Transcript >Ophio5|4082
ATGCGCATCCTCTGCGTCCACGGAGCCGCAATCAACGGCGAGATATTCGCTGCCAAGACGGAAAAGCTCCGATCT
CTTCTGCCGGCCGAGTATTCGTACGACTGGCCCGATGGCGATCACCAGGCCACGCCCACCAAAGATCTCTCGGAT
GCTTACCCAGGACCATATCTGACGCACATCGAGGACATCACCACACTCGGCATCCGGAAATCCATCGAGAGACTC
GAGGCCTGTATCGAAGAGGATGGTCCGTTTGACGGCGTCATGGCAATCTGCGAGGGGGCCATGCTCACCGCATCT
CTGCTCTTCAAGCGGCAGATGGAGAACCCAACAGGACCGCTTCCCTTCCGGTTCGCCATCTTCATAGCCGGCTCA
CCTCCCTTTACGTGGACCGACTCCATCGGACAGAACCTGTTCGACCAACTCATCAGCGACGACCCCTTCAACTTG
GACAAGGACAAGTTCGAGCCTGACGAAAAGAGCGACTGCAAGCCCAACGTGGAGCGCATCAAAGACTTTGGCCAA
AAGGTATACAGGGACCTGACTCCAGAGCTGGGCAAATGGGTCCAGCTCGTCGAAGAGATGGGCACCGGCAACCGG
GAAAAGGCTCATCTCATGCCGCACGCTCTACTGCCCCAGCTGCACCCAGACAGACTCGATCTGCCGACGGCCCAT
ATGTGGGGACGAAAGGACGTCTTGAGCAGCCATTCCAGACTCCTGTTTCGGTTGTGCTGCCCGGAACTGGCGCTG
AGTTATGTGCACCAGGGGGCACACGATATTCCGCAGTCGTGGTCGGACAATGAGGCTTTTGGTGACTTGGTTCGG
AAGATGATCCTTCGCAGCCAGTTTGCTCTGTAG
Gene >Ophio5|4082
ATGCGCATCCTCTGCGTCCACGGAGCCGCAATCAACGGCGAGATATTCGCTGCCAAGACGGAAAAGCTCCGATCT
CTTCTGCCGGCCGAGTATTCGTACGACTGGCCCGATGGCGATCACCAGGCCACGCCCACCAAAGATCTCTCGGAT
GCTTACCCAGGACCATATCTGACGCACATCGAGGACATCACCACACTCGGCATCCGGAAATCCATCGAGAGACTC
GAGGCCTGTATCGAAGAGGATGGTCCGTTTGACGGCGTCATGGCAATCTGCGAGGTGCCTCTCCTACAGCTCTGT
TCCCATCCGAGAGGGCAAAAACAAAACTGACGCGTCAATCAGGGGGCCATGCTCACCGCATCTCTGCTCTTCAAG
CGGCAGATGGAGAACCCAACAGGACCGCTTCCCTTCCGGTTCGCCATCTTCATAGCCGGCTCACCTCCCTTTACG
TGGACCGACTCCATCGGACAGAACCTGTTCGACCAACTCATCAGCGACGACCCCTTCAACTTGGACAAGGACAAG
TTCGAGCCTGACGAAAAGAGCGACTGCAAGCCCAACGTGGAGCGCATCAAAGACTTTGGCCAAAAGGTATACAGG
GACCTGACTCCAGAGCTGGGCAAATGGGTCCAGCTCGTCGAAGAGATGGGCACCGGCAACCGGGAAAAGGCTCAT
CTCATGCCGCACGCTCTACTGCCCCAGCTGCACCCAGACAGACTCGATCTGCCGACGGCCCATATGTGGGGACGA
AAGGACGTCTTGAGCAGCCATTCCAGACTCCTGTTTCGGTTGTGCTGCCCGGAACTGGCGCTGAGTTATGTGCAC
CAGGGGGCACACGATATTCCGCAGTCGTGGTCGGACAATGAGGCTTTTGGTGACTTGGTTCGGAAGATGATCCTT
CGCAGCCAGTTTGCTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail