Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4081
Gene name
Locationscaffold_32:26591..27650
Strand-
Gene length (bp)1059
Transcript length (bp)981
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 1.6E-52 13 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q45423|TFDA_BURSR Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase OS=Burkholderia sp. (strain RASC) GN=tfdA PE=3 SV=1 16 303 8.0E-35
sp|P10088|TFDA_CUPPJ Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdA PE=1 SV=1 10 307 8.0E-33
sp|Q700X4|SDPA_SPHHM (S)-phenoxypropionate/alpha-ketoglutarate-dioxygenase OS=Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) GN=sdpA PE=1 SV=1 8 310 2.0E-22
sp|Q9WWU5|ATSK_PSEPU Alpha-ketoglutarate-dependent sulfate ester dioxygenase OS=Pseudomonas putida GN=atsK PE=1 SV=1 11 303 1.0E-18
sp|Q82IY7|PTLD_STRAW Pentalenolactone F synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlD PE=1 SV=1 20 311 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q45423|TFDA_BURSR Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase OS=Burkholderia sp. (strain RASC) GN=tfdA PE=3 SV=1 16 303 8.0E-35
sp|P10088|TFDA_CUPPJ Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdA PE=1 SV=1 10 307 8.0E-33
sp|Q700X4|SDPA_SPHHM (S)-phenoxypropionate/alpha-ketoglutarate-dioxygenase OS=Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) GN=sdpA PE=1 SV=1 8 310 2.0E-22
sp|Q9WWU5|ATSK_PSEPU Alpha-ketoglutarate-dependent sulfate ester dioxygenase OS=Pseudomonas putida GN=atsK PE=1 SV=1 11 303 1.0E-18
sp|Q82IY7|PTLD_STRAW Pentalenolactone F synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlD PE=1 SV=1 20 311 3.0E-17
sp|P83309|SDPA_DELAC (S)-phenoxypropionate/alpha-ketoglutarate-dioxygenase OS=Delftia acidovorans GN=sdpA PE=1 SV=2 9 285 2.0E-16
sp|Q8KSC8|RDPA_SPHHM (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase OS=Sphingobium herbicidovorans (strain ATCC 700291 / DSM 11019 / NBRC 16415 / MH) GN=rdpA PE=1 SV=2 1 303 6.0E-15
sp|P83310|RDPA_DELAC (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase OS=Delftia acidovorans GN=rdpA PE=1 SV=2 1 303 6.0E-15
sp|P37610|TAUD_ECOLI Alpha-ketoglutarate-dependent taurine dioxygenase OS=Escherichia coli (strain K12) GN=tauD PE=1 SV=3 8 303 1.0E-13
sp|E3VWI8|PNTD_STRAE Pentalenolactone F synthase OS=Streptomyces arenae GN=pntD PE=3 SV=1 20 311 6.0E-13
sp|E3VWK4|PEND_STREX Pentalenolactone F synthase OS=Streptomyces exfoliatus GN=penD PE=3 SV=1 128 311 7.0E-12
sp|P9WKZ1|ATSK_MYCTU Alpha-ketoglutarate-dependent sulfate ester dioxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3406 PE=1 SV=1 11 303 2.0E-10
sp|P9WKZ0|ATSK_MYCTO Alpha-ketoglutarate-dependent sulfate ester dioxygenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3514 PE=3 SV=1 11 303 2.0E-10
sp|P65076|ATSK_MYCBO Alpha-ketoglutarate-dependent sulfate ester dioxygenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3440 PE=3 SV=1 11 303 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4081
MSSMSAGSSSLTFYPLHPTFGAECRGVDFSRPLSRQIIDGIRKAMARYGVLVFRRTELDDASHQRLARCFGEPDV
SAIDLTTPLNGQGQDYRLSPFNELVDGGNVDESGQPEPVDSLKSQLYKANNLFHVDCSYNPRRAGYSILRAHQLP
PKGLGGATAFADTRTAYRELDDETKREIHNYVAWHSLLHSRRVAAPDLELLRLLRHGDLPVSRHKLVQKHEPSGR
MNLYIAAHVYRINDWSEEQSLPTIQRLLRHASQDKYIFTVDWENNGDLVMWDNTCVMHRACGGSFEGKHVRDMRR
ATVYDSSSTAWGLNRSEEQGALEAKL
Coding >Ophio5|4081
ATGTCATCAATGTCCGCCGGCTCGTCCTCACTCACCTTTTACCCCTTACATCCAACTTTTGGCGCTGAGTGCCGC
GGCGTTGACTTCTCGCGGCCGCTGTCTCGGCAAATCATCGATGGCATCCGCAAAGCCATGGCCAGGTACGGCGTC
CTGGTCTTTCGCCGGACTGAGCTCGACGACGCCAGTCATCAGCGGCTGGCGCGGTGCTTTGGCGAGCCGGACGTC
TCGGCCATAGACCTGACTACGCCTCTCAACGGACAAGGCCAAGATTATCGTCTCTCGCCCTTCAACGAGCTCGTC
GACGGGGGCAACGTCGACGAGAGTGGCCAGCCCGAGCCCGTAGACAGCCTCAAGTCACAGCTATACAAGGCCAAC
AACCTCTTTCACGTCGATTGCAGCTACAACCCGCGTCGAGCCGGTTACTCCATCCTCCGCGCCCACCAGCTACCC
CCCAAGGGGTTGGGAGGCGCAACGGCTTTTGCCGATACAAGGACGGCGTACAGGGAGCTCGACGACGAGACGAAG
CGGGAGATTCACAACTACGTGGCCTGGCACTCTCTCCTCCATAGTAGAAGAGTGGCAGCTCCCGATCTGGAATTG
CTCCGGTTGTTACGGCACGGAGATCTCCCTGTAAGCCGCCACAAGCTGGTACAGAAGCACGAGCCCAGTGGACGG
ATGAATCTGTACATCGCGGCGCACGTTTACCGCATAAACGACTGGTCGGAAGAGCAGAGCCTGCCGACCATCCAA
CGGCTGCTTCGGCACGCCAGCCAGGATAAGTACATCTTCACCGTCGACTGGGAGAACAACGGGGATCTGGTCATG
TGGGATAACACGTGCGTCATGCACAGAGCGTGTGGCGGCTCTTTCGAGGGCAAGCATGTGCGTGATATGAGGAGA
GCAACGGTCTACGACAGCTCGTCTACTGCTTGGGGACTGAATCGATCAGAGGAGCAAGGGGCGCTGGAAGCCAAG
CTG
Transcript >Ophio5|4081
ATGTCATCAATGTCCGCCGGCTCGTCCTCACTCACCTTTTACCCCTTACATCCAACTTTTGGCGCTGAGTGCCGC
GGCGTTGACTTCTCGCGGCCGCTGTCTCGGCAAATCATCGATGGCATCCGCAAAGCCATGGCCAGGTACGGCGTC
CTGGTCTTTCGCCGGACTGAGCTCGACGACGCCAGTCATCAGCGGCTGGCGCGGTGCTTTGGCGAGCCGGACGTC
TCGGCCATAGACCTGACTACGCCTCTCAACGGACAAGGCCAAGATTATCGTCTCTCGCCCTTCAACGAGCTCGTC
GACGGGGGCAACGTCGACGAGAGTGGCCAGCCCGAGCCCGTAGACAGCCTCAAGTCACAGCTATACAAGGCCAAC
AACCTCTTTCACGTCGATTGCAGCTACAACCCGCGTCGAGCCGGTTACTCCATCCTCCGCGCCCACCAGCTACCC
CCCAAGGGGTTGGGAGGCGCAACGGCTTTTGCCGATACAAGGACGGCGTACAGGGAGCTCGACGACGAGACGAAG
CGGGAGATTCACAACTACGTGGCCTGGCACTCTCTCCTCCATAGTAGAAGAGTGGCAGCTCCCGATCTGGAATTG
CTCCGGTTGTTACGGCACGGAGATCTCCCTGTAAGCCGCCACAAGCTGGTACAGAAGCACGAGCCCAGTGGACGG
ATGAATCTGTACATCGCGGCGCACGTTTACCGCATAAACGACTGGTCGGAAGAGCAGAGCCTGCCGACCATCCAA
CGGCTGCTTCGGCACGCCAGCCAGGATAAGTACATCTTCACCGTCGACTGGGAGAACAACGGGGATCTGGTCATG
TGGGATAACACGTGCGTCATGCACAGAGCGTGTGGCGGCTCTTTCGAGGGCAAGCATGTGCGTGATATGAGGAGA
GCAACGGTCTACGACAGCTCGTCTACTGCTTGGGGACTGAATCGATCAGAGGAGCAAGGGGCGCTGGAAGCCAAG
CTGTAG
Gene >Ophio5|4081
ATGTCATCAATGTCCGCCGGCTCGTCCTCACTCACCTTTTACCCCTTACATCCAACTTTTGGCGCTGAGTGCCGC
GGCGTTGACTTCTCGCGGCCGCTGTCTCGGCAAATCATCGATGGCATCCGCAAAGCCATGGCCAGGTACGGCGTC
CTGGTCTTTCGCCGGACTGAGCTCGACGACGCCAGTCATCAGCGGCTGGCGCGGTGCTTTGGCGAGCCGGACGTC
TCGGCCATAGACCTGACTACGCCTCTCAACGGACAAGGCCAAGATTATCGTCTCTCGCCCTTCAACGAGCTCGTC
GACGGGGGCAACGTCGACGAGAGTGGCCAGCCCGAGCCCGTAGACAGCCTCAAGTCACAGCTATACAAGGCCAAC
AACCTCTTTCACGTCGATTGCAGCTACAACCCGCGTCGAGCCGGTTACTCCATCCTCCGCGCCCACCAGCTACCC
CCCAAGGGGTTGGGAGGCGCAACGGCTTTTGCCGATACAAGGACGGCGTACAGGGAGCTCGACGACGAGACGAAG
CGGGAGATTCACAACTACGTGGCCTGGCACTCTCTCCTCCATAGTAGAAGAGTGGCAGCTCCCGATCTGGAATTG
CTCCGGTTGTTACGGCACGGAGATCTCCCTGTAAGCCGCCACAAGCTGGTACAGAAGCACGAGCCCAGTGGACGG
ATGAATCTGTACATCGCGGCGCACGTTTACCGCATAAACGACTGGTCGGAAGAGCAGAGCCTGCCGACCATCCAA
CGGCTGCTTCGGCACGCCAGCCAGGATAAGTACATCTTCACCGTCGACTGGGAGAACAACGGGGATCTGGTCATG
TGGGTGAGTTGTTGAGGCTGGGACGACTCGAGCGAGTTTGGAGGCTAACCATAGCGTCGTCGTCGTCGTCGTCGT
CATCAGGATAACACGTGCGTCATGCACAGAGCGTGTGGCGGCTCTTTCGAGGGCAAGCATGTGCGTGATATGAGG
AGAGCAACGGTCTACGACAGCTCGTCTACTGCTTGGGGACTGAATCGATCAGAGGAGCAAGGGGCGCTGGAAGCC
AAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail