Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4077
Gene name
Locationscaffold_32:15932..17302
Strand+
Gene length (bp)1370
Transcript length (bp)1314
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 5.8E-29 106 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 93 353 2.0E-32
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 93 353 3.0E-32
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 93 353 5.0E-32
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 93 353 9.0E-32
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 86 353 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 93 353 2.0E-32
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 93 353 3.0E-32
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 93 353 5.0E-32
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 93 353 9.0E-32
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 86 353 1.0E-30
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 93 353 1.0E-28
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 93 392 2.0E-28
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 93 353 3.0E-28
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 93 353 5.0E-28
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 92 353 2.0E-27
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 84 356 6.0E-27
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 93 353 8.0E-27
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 94 353 1.0E-26
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 93 353 3.0E-26
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 84 353 2.0E-25
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 94 353 8.0E-25
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 93 353 1.0E-24
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 93 353 3.0E-24
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 61 380 7.0E-24
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 61 380 2.0E-23
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 93 380 3.0E-23
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 100 334 1.0E-19
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 110 340 2.0E-19
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 96 341 6.0E-18
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 115 339 2.0E-17
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 110 339 2.0E-17
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 115 339 3.0E-17
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 98 339 4.0E-17
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 110 339 6.0E-17
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 122 339 1.0E-16
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 115 341 8.0E-16
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 110 341 8.0E-16
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 110 341 9.0E-16
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 122 340 1.0E-13
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 122 340 1.0E-13
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 122 340 6.0E-13
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 122 340 1.0E-12
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 157 353 1.0E-12
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 122 340 7.0E-12
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 54 339 2.0E-11
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 54 339 2.0E-11
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 85 339 3.0E-11
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 81 339 1.0E-10
sp|Q6URB0|CCPR_CRYNH Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CCP1 PE=3 SV=1 43 339 2.0E-10
sp|Q96511|PER69_ARATH Peroxidase 69 OS=Arabidopsis thaliana GN=PER69 PE=1 SV=1 122 344 2.0E-10
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 122 340 3.0E-10
sp|Q9SK52|PER18_ARATH Peroxidase 18 OS=Arabidopsis thaliana GN=PER18 PE=3 SV=1 122 340 4.0E-10
sp|Q02200|PERX_NICSY Lignin-forming anionic peroxidase OS=Nicotiana sylvestris PE=2 SV=1 108 334 7.0E-10
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 117 259 2.0E-09
sp|Q9SJZ2|PER17_ARATH Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1 98 334 2.0E-09
sp|Q9M9Q9|PER5_ARATH Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=3 SV=2 105 334 3.0E-09
sp|Q4ING3|CCPR_GIBZE Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CCP1 PE=3 SV=1 89 339 3.0E-09
sp|Q6BKY9|CCPR_DEBHA Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCP1 PE=3 SV=1 123 350 7.0E-09
sp|Q9LVL1|PER68_ARATH Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=2 SV=1 77 334 7.0E-09
sp|P11965|PERX_TOBAC Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1 122 334 1.0E-08
sp|O48677|PER6_ARATH Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 SV=1 118 340 1.0E-08
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 122 386 5.0E-08
sp|Q9FL16|PER63_ARATH Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1 101 339 8.0E-08
sp|Q96512|PER9_ARATH Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1 117 257 8.0E-08
sp|O04795|PERA_IPOBA Anionic peroxidase OS=Ipomoea batatas PE=1 SV=1 78 337 3.0E-07
sp|Q4PD66|CCPR2_USTMA Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP2 PE=3 SV=1 122 339 3.0E-07
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 116 340 4.0E-07
sp|Q9SZB9|PER47_ARATH Peroxidase 47 OS=Arabidopsis thaliana GN=PER47 PE=2 SV=2 99 340 5.0E-07
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 90 339 6.0E-07
sp|Q9LVL2|PER67_ARATH Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=2 SV=1 122 334 1.0E-06
sp|Q9FLC0|PER52_ARATH Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1 115 334 1.0E-06
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 122 340 2.0E-06
sp|Q4W1I8|PER1_ZINVI Basic peroxidase OS=Zinnia violacea GN=POD1 PE=1 SV=1 105 260 2.0E-06
sp|Q4W1I9|PER2_ZINVI Basic peroxidase OS=Zinnia violacea GN=POD3 PE=1 SV=1 105 260 2.0E-06
sp|P15004|PER2_SOLLC Suberization-associated anionic peroxidase 2 OS=Solanum lycopersicum GN=TAP2 PE=3 SV=1 122 359 2.0E-06
sp|P00434|PERP7_BRARR Peroxidase P7 OS=Brassica rapa subsp. rapa PE=1 SV=3 122 260 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0006950 response to stress No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0050896 response to stimulus No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4077
MKYTSSFILIAATAGLSSAFSPTQMHEVKVRAARSSSVSPQLLGDLATLSEQQLTSTGRAIKAILLKQDSGLDTG
SAPVNGELGSSQCNEDVCCVWKVIADDMAKTMVGSDRQCNSLARAAIRLGFHDAGAWSTESEVGGADGSIVLAGE
CESRAENNGLQEICERMRSWFDQYQQYSVSMADLIQMGANVGAVVCPLGPRVRSFVGRKDSNSPAPEGLLPGPEL
SADRLITMFASKTISPQGLIALVGSHSVAQQRFVQTNRSGDALDSTPGIWDTNFFRQVLDPKASPRIFKLQSDVS
LSRDQRTTDVWSAYAGAQAQQSFIDDYATEYVRLSLLGVQNINDLIECTEALPPYIASFAVSDSNASSRPVDSDR
PSCSSGGSTSGILPKGSWPSSSNGLQGLFSGARHANRPPAAGRKPQSSVPRAGNQEEGSNPR
Coding >Ophio5|4077
ATGAAGTATACGAGCTCTTTTATCTTGATAGCCGCCACGGCCGGTCTTTCATCCGCCTTCTCACCGACGCAGATG
CACGAGGTCAAGGTCAGGGCAGCAAGGTCGAGCTCAGTCTCGCCCCAGCTGCTCGGCGACCTGGCGACGCTCAGC
GAGCAGCAGCTGACGTCGACAGGCAGGGCCATCAAGGCCATACTATTGAAGCAAGACAGCGGACTCGACACTGGC
TCGGCCCCGGTGAACGGCGAACTTGGTTCGAGCCAGTGCAACGAGGACGTGTGCTGCGTGTGGAAGGTCATCGCC
GACGACATGGCAAAGACCATGGTCGGATCGGACCGTCAATGCAACAGCCTTGCCCGGGCCGCCATTCGGCTCGGC
TTCCACGATGCGGGAGCCTGGTCGACGGAGTCGGAGGTTGGAGGCGCCGACGGCTCCATCGTTCTGGCGGGAGAG
TGCGAGAGTCGTGCGGAGAATAACGGGTTGCAAGAGATCTGCGAGCGCATGCGATCCTGGTTCGATCAATACCAG
CAGTATAGCGTCTCCATGGCCGACTTGATCCAGATGGGCGCCAACGTCGGCGCCGTTGTCTGTCCTCTCGGGCCT
CGAGTCCGGTCCTTCGTCGGCCGCAAAGATAGCAATAGTCCTGCCCCTGAGGGTCTGCTCCCGGGTCCTGAATTG
AGCGCCGACAGGCTCATCACCATGTTCGCCAGCAAAACTATCAGCCCCCAGGGGCTCATCGCTCTCGTCGGCTCC
CATTCGGTCGCACAGCAGCGCTTCGTCCAGACGAACCGAAGCGGCGACGCGCTTGATTCCACCCCTGGCATCTGG
GATACCAACTTCTTCCGCCAAGTGCTCGATCCTAAAGCTTCGCCGCGTATCTTTAAGCTGCAAAGCGACGTCAGC
CTCAGCAGGGACCAGCGCACCACGGACGTCTGGAGTGCCTATGCCGGAGCCCAAGCACAACAGTCCTTTATAGAT
GACTATGCAACCGAATACGTTCGTCTCAGTCTCTTAGGCGTTCAAAACATCAACGACCTGATCGAGTGCACCGAG
GCTTTGCCACCTTATATTGCCAGCTTCGCAGTCTCGGACTCGAACGCGTCATCCAGGCCAGTGGACAGCGACAGG
CCGAGTTGTTCCTCGGGTGGCTCGACGAGCGGCATCTTGCCAAAGGGATCTTGGCCAAGCAGTAGCAACGGGTTG
CAGGGCTTGTTTTCAGGTGCTAGACACGCCAACAGGCCACCTGCTGCTGGTAGGAAGCCACAGAGCTCAGTCCCG
CGTGCTGGTAATCAGGAGGAGGGCTCGAATCCGCGT
Transcript >Ophio5|4077
ATGAAGTATACGAGCTCTTTTATCTTGATAGCCGCCACGGCCGGTCTTTCATCCGCCTTCTCACCGACGCAGATG
CACGAGGTCAAGGTCAGGGCAGCAAGGTCGAGCTCAGTCTCGCCCCAGCTGCTCGGCGACCTGGCGACGCTCAGC
GAGCAGCAGCTGACGTCGACAGGCAGGGCCATCAAGGCCATACTATTGAAGCAAGACAGCGGACTCGACACTGGC
TCGGCCCCGGTGAACGGCGAACTTGGTTCGAGCCAGTGCAACGAGGACGTGTGCTGCGTGTGGAAGGTCATCGCC
GACGACATGGCAAAGACCATGGTCGGATCGGACCGTCAATGCAACAGCCTTGCCCGGGCCGCCATTCGGCTCGGC
TTCCACGATGCGGGAGCCTGGTCGACGGAGTCGGAGGTTGGAGGCGCCGACGGCTCCATCGTTCTGGCGGGAGAG
TGCGAGAGTCGTGCGGAGAATAACGGGTTGCAAGAGATCTGCGAGCGCATGCGATCCTGGTTCGATCAATACCAG
CAGTATAGCGTCTCCATGGCCGACTTGATCCAGATGGGCGCCAACGTCGGCGCCGTTGTCTGTCCTCTCGGGCCT
CGAGTCCGGTCCTTCGTCGGCCGCAAAGATAGCAATAGTCCTGCCCCTGAGGGTCTGCTCCCGGGTCCTGAATTG
AGCGCCGACAGGCTCATCACCATGTTCGCCAGCAAAACTATCAGCCCCCAGGGGCTCATCGCTCTCGTCGGCTCC
CATTCGGTCGCACAGCAGCGCTTCGTCCAGACGAACCGAAGCGGCGACGCGCTTGATTCCACCCCTGGCATCTGG
GATACCAACTTCTTCCGCCAAGTGCTCGATCCTAAAGCTTCGCCGCGTATCTTTAAGCTGCAAAGCGACGTCAGC
CTCAGCAGGGACCAGCGCACCACGGACGTCTGGAGTGCCTATGCCGGAGCCCAAGCACAACAGTCCTTTATAGAT
GACTATGCAACCGAATACGTTCGTCTCAGTCTCTTAGGCGTTCAAAACATCAACGACCTGATCGAGTGCACCGAG
GCTTTGCCACCTTATATTGCCAGCTTCGCAGTCTCGGACTCGAACGCGTCATCCAGGCCAGTGGACAGCGACAGG
CCGAGTTGTTCCTCGGGTGGCTCGACGAGCGGCATCTTGCCAAAGGGATCTTGGCCAAGCAGTAGCAACGGGTTG
CAGGGCTTGTTTTCAGGTGCTAGACACGCCAACAGGCCACCTGCTGCTGGTAGGAAGCCACAGAGCTCAGTCCCG
CGTGCTGGTAATCAGGAGGAGGGCTCGAATCCGCGTTGA
Gene >Ophio5|4077
ATGAAGTATACGAGCTCTTTTATCTTGATAGCCGCCACGGCCGGTCTTTCATCCGCCTTCTCACCGACGCAGATG
CACGAGGTCAAGGTCAGGGCAGCAAGGTCGAGCTCAGTCTCGCCCCAGCTGCTCGGCGACCTGGCGACGCTCAGC
GAGCAGCAGCTGACGTCGACAGGCAGGGCCATCAAGGCCATACTATTGAAGCAAGACAGCGGACTCGACACTGGC
TCGGCCCCGGTGAACGGCGAACTTGGTTCGAGCCAGTGCAACGAGGACGTGTGCTGCGTGTGGAAGGTCATCGCC
GACGACATGGCAAAGACCATGGTCGGATCGGACCGTCAATGCAACAGCCTTGCCCGGGCCGCCATTCGGCTCGGC
TTCCACGATGCGGGAGCCTGGTCGACGGAGTCGGAGGTTGGAGGCGCCGACGGCTCCATCGTTCTGGCGGGAGAG
TGCGAGAGTCGTGCGGAGAATAACGGGTTGCAAGAGATCTGCGAGCGCATGCGATCCTGGTTCGATCAATACCAG
CAGTATAGCGTCTCCATGGCCGACTTGATCCAGATGGGCGCCAACGTCGGCGCCGTTGTCTGTCCTCTCGGGCCT
CGAGTCCGGTCCTTCGTCGGCCGCAAAGATAGCAATAGTCCTGCCCCTGAGGGTCTGCTCCCGGGTCCTGAATTG
AGCGCCGACAGGCTCATCACCATGTTCGCCAGCAAAACTATCAGCCCCCAGGGGCTCATCGCTCTCGTCGGCTCC
CATTCGGTCGCACAGCAGCGCTTCGTCCAGACGAACCGAAGCGGCGACGCGCTTGATTCCACCCCTGGCATCTGG
GATACCAACTTCTTCCGCCAAGTGCTCGATCCTAAAGCTTCGCCGCGTATCTTTAAGCTGCAAAGCGACGTCAGC
CTCAGCAGGGACCAGCGCACCACGGACGTCTGGAGTGCCTATGCCGGAGCCCAAGCACAACAGTCCTTTATAGAT
GTGAGCATGTGTGAAGCCGGCGGCTTCGAGTTTCTGACTTGAGCGGTTTTCTATAGGACTATGCAACCGAATACG
TTCGTCTCAGTCTCTTAGGCGTTCAAAACATCAACGACCTGATCGAGTGCACCGAGGCTTTGCCACCTTATATTG
CCAGCTTCGCAGTCTCGGACTCGAACGCGTCATCCAGGCCAGTGGACAGCGACAGGCCGAGTTGTTCCTCGGGTG
GCTCGACGAGCGGCATCTTGCCAAAGGGATCTTGGCCAAGCAGTAGCAACGGGTTGCAGGGCTTGTTTTCAGGTG
CTAGACACGCCAACAGGCCACCTGCTGCTGGTAGGAAGCCACAGAGCTCAGTCCCGCGTGCTGGTAATCAGGAGG
AGGGCTCGAATCCGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail