Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4076
Gene name
Locationscaffold_32:9362..13407
Strand-
Gene length (bp)4045
Transcript length (bp)3927
Coding sequence length (bp)3924
Protein length (aa) 1308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 1.9E-38 51 323
PF00664 ABC_membrane ABC transporter transmembrane region 1.5E-35 759 1027
PF00005 ABC_tran ABC transporter 4.7E-27 393 542
PF00005 ABC_tran ABC transporter 1.8E-23 1091 1225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 43 1295 9.0E-153
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 32 1298 3.0E-140
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 22 1285 1.0E-128
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 88 1292 1.0E-127
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 17 1294 9.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 43 1295 9.0E-153
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 32 1298 3.0E-140
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 22 1285 1.0E-128
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 88 1292 1.0E-127
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 17 1294 9.0E-118
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 65 1293 3.0E-117
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 37 1293 6.0E-117
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 76 1294 5.0E-115
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 26 1293 3.0E-114
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 92 1293 9.0E-112
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 131 1292 1.0E-109
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 79 1296 2.0E-105
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 31 1294 2.0E-105
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 118 1296 3.0E-104
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 79 1296 4.0E-103
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 82 1296 1.0E-96
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 53 1287 2.0E-94
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 20 598 3.0E-70
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 26 598 6.0E-69
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 25 598 1.0E-65
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 53 598 2.0E-65
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 94 632 3.0E-65
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 36 598 7.0E-65
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 31 593 1.0E-64
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 48 598 2.0E-64
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 92 598 6.0E-64
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 92 598 3.0E-63
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 92 598 3.0E-63
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 47 578 6.0E-63
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 36 598 6.0E-63
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 59 598 7.0E-63
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 48 598 7.0E-63
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 85 598 1.0E-62
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 92 598 1.0E-62
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 92 598 3.0E-62
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 118 598 6.0E-62
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 92 598 9.0E-62
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 92 598 1.0E-61
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 31 598 4.0E-61
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 131 593 7.0E-61
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 92 598 9.0E-61
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 47 598 1.0E-60
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 92 598 2.0E-60
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 32 602 2.0E-60
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 753 1294 3.0E-60
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 105 602 4.0E-60
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 28 598 5.0E-60
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 28 598 7.0E-60
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 25 598 8.0E-60
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 49 598 8.0E-60
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 131 598 8.0E-59
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 48 598 2.0E-58
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 131 598 2.0E-58
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 655 1294 4.0E-58
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 94 593 4.0E-58
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 85 623 5.0E-58
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 94 598 5.0E-58
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 131 598 6.0E-58
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 131 598 6.0E-58
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 131 598 6.0E-58
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 94 598 6.0E-58
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 94 598 6.0E-58
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 94 598 6.0E-58
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 94 598 6.0E-58
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 131 593 7.0E-58
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 105 598 7.0E-58
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 94 598 8.0E-58
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 36 620 8.0E-58
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 54 598 1.0E-57
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 30 602 3.0E-57
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 94 598 3.0E-57
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 118 598 4.0E-57
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 655 1294 5.0E-57
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 131 598 5.0E-57
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 131 598 5.0E-57
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 131 598 5.0E-57
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 131 598 6.0E-57
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 73 598 7.0E-57
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 24 598 9.0E-57
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 748 1294 1.0E-56
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 31 598 2.0E-56
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 15 623 2.0E-56
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 748 1294 3.0E-56
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 24 602 3.0E-56
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 763 1294 4.0E-56
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 19 598 4.0E-56
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 21 593 4.0E-56
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 66 629 4.0E-56
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 19 598 5.0E-56
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 25 598 6.0E-56
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 76 598 7.0E-56
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 758 1286 9.0E-56
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 3 598 1.0E-55
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 3 598 2.0E-55
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 772 1294 2.0E-55
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 2 593 2.0E-55
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 94 598 2.0E-55
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 94 598 2.0E-55
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 21 598 3.0E-55
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 49 598 3.0E-55
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 25 598 3.0E-55
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 94 598 4.0E-55
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 53 597 6.0E-55
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 21 598 7.0E-55
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 94 598 8.0E-55
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 102 610 9.0E-55
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 737 1294 1.0E-54
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 131 593 1.0E-54
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 49 598 2.0E-54
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 669 1296 2.0E-54
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 763 1294 2.0E-54
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 131 598 2.0E-54
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 50 598 2.0E-54
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 131 601 2.0E-54
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 97 617 3.0E-54
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 105 598 3.0E-54
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 111 600 3.0E-54
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 33 598 3.0E-54
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 19 598 4.0E-54
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 749 1286 4.0E-54
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 729 1286 4.0E-54
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 119 598 4.0E-54
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 655 1296 5.0E-54
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 35 600 6.0E-54
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 48 602 6.0E-54
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 49 598 8.0E-54
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 56 586 8.0E-54
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 49 598 9.0E-54
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 131 598 9.0E-54
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 102 598 1.0E-53
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 758 1293 2.0E-53
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 91 649 2.0E-53
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 26 589 2.0E-53
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 131 598 3.0E-53
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 131 598 3.0E-53
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 131 598 3.0E-53
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 131 598 3.0E-53
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 19 598 4.0E-53
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 131 593 6.0E-53
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 822 1293 1.0E-52
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 100 598 1.0E-52
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 831 1308 2.0E-52
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 50 593 2.0E-52
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 131 593 2.0E-52
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 131 601 2.0E-52
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 718 1294 3.0E-52
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 727 1285 3.0E-52
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 89 593 3.0E-52
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 831 1293 4.0E-52
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 105 602 4.0E-52
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 831 1294 5.0E-52
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 760 1294 5.0E-52
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 24 593 5.0E-52
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 94 598 6.0E-52
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 748 1296 8.0E-52
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 772 1294 8.0E-52
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 105 602 8.0E-52
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 105 602 8.0E-52
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 745 1283 1.0E-51
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 92 598 1.0E-51
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 131 598 1.0E-51
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 21 591 2.0E-51
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 131 601 2.0E-51
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 131 598 2.0E-51
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 94 602 2.0E-51
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 94 602 2.0E-51
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 822 1294 3.0E-51
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 748 1294 3.0E-51
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 831 1293 3.0E-51
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 6 602 4.0E-51
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 831 1293 5.0E-51
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 831 1308 5.0E-51
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 716 1302 5.0E-51
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 153 598 5.0E-51
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 131 598 6.0E-51
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 103 598 9.0E-51
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 831 1293 1.0E-50
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 153 598 1.0E-50
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 131 600 1.0E-50
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 721 1294 2.0E-50
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 831 1294 2.0E-50
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 102 579 3.0E-50
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 94 598 3.0E-50
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 20 593 5.0E-50
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 96 598 5.0E-50
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 29 598 5.0E-50
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 102 593 1.0E-49
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 62 601 2.0E-49
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 53 602 2.0E-49
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 94 593 2.0E-49
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 757 1299 3.0E-49
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 131 600 3.0E-49
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 110 598 3.0E-49
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 65 634 4.0E-49
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 53 598 4.0E-49
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 107 598 5.0E-49
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 164 609 5.0E-49
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 131 598 8.0E-49
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 739 1294 9.0E-49
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 757 1293 1.0E-48
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 102 598 1.0E-48
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 766 1294 2.0E-48
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 748 1283 3.0E-48
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 131 601 3.0E-48
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 94 598 3.0E-48
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 723 1292 4.0E-48
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 94 598 4.0E-48
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 94 598 4.0E-48
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 94 598 6.0E-48
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 131 598 7.0E-48
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 107 598 8.0E-48
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 107 598 8.0E-48
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 107 598 8.0E-48
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 107 598 8.0E-48
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 107 598 8.0E-48
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 107 598 8.0E-48
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 107 598 8.0E-48
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 107 598 8.0E-48
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 131 598 8.0E-48
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 131 598 1.0E-47
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 107 598 2.0E-47
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 69 593 2.0E-47
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 131 598 3.0E-47
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 746 1294 4.0E-47
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 131 600 6.0E-47
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 823 1294 8.0E-47
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 102 598 8.0E-47
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 131 602 9.0E-47
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 131 593 9.0E-47
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 99 675 1.0E-46
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 89 598 1.0E-46
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 66 598 2.0E-46
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 758 1292 2.0E-46
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 102 598 2.0E-46
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 822 1287 3.0E-46
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 106 596 3.0E-46
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 131 598 3.0E-46
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 131 598 3.0E-46
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 131 598 3.0E-46
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 800 1305 4.0E-46
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 106 600 4.0E-46
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 113 598 4.0E-46
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 113 598 5.0E-46
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 133 598 5.0E-46
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 670 1292 5.0E-46
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 131 598 6.0E-46
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 120 602 9.0E-46
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 47 602 9.0E-46
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 47 602 9.0E-46
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 831 1294 1.0E-45
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 131 598 1.0E-45
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 106 600 2.0E-45
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 34 598 3.0E-45
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 800 1296 4.0E-45
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 131 601 4.0E-45
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 49 598 4.0E-45
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 49 598 4.0E-45
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 49 598 4.0E-45
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 133 600 4.0E-45
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 47 602 4.0E-45
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 47 602 4.0E-45
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 120 602 5.0E-45
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 133 598 5.0E-45
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 133 598 6.0E-45
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 131 602 6.0E-45
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 133 600 7.0E-45
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 131 596 7.0E-45
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 133 598 8.0E-45
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 757 1293 1.0E-44
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 106 593 1.0E-44
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 132 600 1.0E-44
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 122 598 1.0E-44
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 131 584 1.0E-44
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 131 602 1.0E-44
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 131 602 1.0E-44
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 131 602 1.0E-44
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 822 1293 2.0E-44
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 133 598 2.0E-44
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 133 598 2.0E-44
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 113 593 3.0E-44
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 131 598 4.0E-44
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 758 1296 5.0E-44
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 133 593 8.0E-44
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 709 1291 1.0E-43
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 800 1296 1.0E-43
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 108 598 1.0E-43
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 95 602 1.0E-43
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 741 1289 2.0E-43
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 726 1285 2.0E-43
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 131 601 3.0E-43
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 800 1292 4.0E-43
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 100 593 4.0E-43
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 133 598 4.0E-43
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 133 598 4.0E-43
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 757 1294 5.0E-43
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 800 1292 5.0E-43
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 133 593 5.0E-43
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 108 598 5.0E-43
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 133 598 6.0E-43
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 131 601 6.0E-43
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 131 598 7.0E-43
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 184 581 8.0E-43
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 122 598 8.0E-43
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 127 598 1.0E-42
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 131 598 1.0E-42
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 106 598 3.0E-42
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 132 602 4.0E-42
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 92 598 5.0E-42
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 133 598 5.0E-42
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 122 593 8.0E-42
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 132 601 8.0E-42
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 757 1293 1.0E-41
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 704 1297 1.0E-41
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 53 602 1.0E-41
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 717 1287 1.0E-41
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 131 589 1.0E-41
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 131 598 1.0E-41
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 1.0E-41
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 52 598 1.0E-41
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 92 598 1.0E-41
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 1.0E-41
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 1.0E-41
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 133 598 1.0E-41
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 30 598 2.0E-41
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 831 1303 2.0E-41
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 2.0E-41
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 2.0E-41
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 2.0E-41
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 133 598 2.0E-41
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 355 593 2.0E-41
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 96 581 2.0E-41
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 800 1293 3.0E-41
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 133 598 3.0E-41
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 106 598 3.0E-41
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 132 617 3.0E-41
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 772 1292 5.0E-41
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 100 598 5.0E-41
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 122 600 6.0E-41
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 143 598 9.0E-41
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 143 598 9.0E-41
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 143 598 9.0E-41
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 798 1293 1.0E-40
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 754 1287 1.0E-40
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 131 601 1.0E-40
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 133 598 2.0E-40
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 828 1286 3.0E-40
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 118 593 3.0E-40
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 831 1293 4.0E-40
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 800 1304 4.0E-40
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 737 1292 5.0E-40
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 64 593 7.0E-40
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 811 1293 1.0E-39
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 131 593 1.0E-39
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 373 593 1.0E-39
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 375 593 1.0E-39
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 831 1293 2.0E-39
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 800 1293 2.0E-39
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 169 593 2.0E-39
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 118 593 2.0E-39
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 800 1304 3.0E-39
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 92 598 3.0E-39
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 92 598 3.0E-39
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 755 1285 5.0E-39
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 800 1296 5.0E-39
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 800 1296 6.0E-39
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 747 1292 8.0E-39
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 737 1292 8.0E-39
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 132 598 8.0E-39
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 131 598 9.0E-39
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 739 1291 9.0E-39
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 800 1296 1.0E-38
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 882 1294 1.0E-38
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 882 1294 1.0E-38
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 882 1294 1.0E-38
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 882 1294 1.0E-38
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 882 1294 1.0E-38
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 882 1294 1.0E-38
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 882 1294 1.0E-38
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 882 1294 1.0E-38
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 882 1294 1.0E-38
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 373 605 1.0E-38
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 375 593 1.0E-38
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 797 1294 2.0E-38
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 724 1293 2.0E-38
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 805 1292 2.0E-38
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 799 1287 2.0E-38
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 831 1301 3.0E-38
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 375 598 3.0E-38
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 800 1296 4.0E-38
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 375 598 4.0E-38
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 50 593 4.0E-38
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 831 1285 5.0E-38
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 831 1293 5.0E-38
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 374 598 5.0E-38
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 742 1287 8.0E-38
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 800 1285 8.0E-38
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 353 593 8.0E-38
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 831 1302 1.0E-37
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 805 1293 1.0E-37
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 738 1293 1.0E-37
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 705 1293 1.0E-37
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 757 1294 1.0E-37
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 795 1287 1.0E-37
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 370 593 1.0E-37
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 799 1302 2.0E-37
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 831 1308 2.0E-37
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 745 1290 2.0E-37
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 196 612 2.0E-37
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 133 590 2.0E-37
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 122 598 2.0E-37
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 131 598 2.0E-37
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 133 590 2.0E-37
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 705 1293 3.0E-37
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 27 598 3.0E-37
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 810 1293 5.0E-37
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 818 1284 5.0E-37
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 131 598 5.0E-37
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 802 1300 6.0E-37
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 831 1301 7.0E-37
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 373 602 8.0E-37
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 831 1293 1.0E-36
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 234 593 1.0E-36
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 133 598 1.0E-36
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 736 1294 2.0E-36
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 339 598 2.0E-36
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 832 1296 3.0E-36
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 852 1299 4.0E-36
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 819 1293 5.0E-36
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 820 1283 5.0E-36
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 131 598 5.0E-36
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 242 598 5.0E-36
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 832 1296 5.0E-36
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 831 1308 7.0E-36
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 788 1293 7.0E-36
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 149 593 8.0E-36
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 883 1285 1.0E-35
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 131 598 1.0E-35
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 790 1287 2.0E-35
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 885 1292 2.0E-35
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 795 1287 2.0E-35
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 726 1292 2.0E-35
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 831 1281 2.0E-35
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 863 1299 2.0E-35
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 353 607 2.0E-35
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 730 1298 3.0E-35
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 820 1283 3.0E-35
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 863 1299 3.0E-35
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 863 1299 3.0E-35
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 863 1299 3.0E-35
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 863 1299 3.0E-35
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 131 602 3.0E-35
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 54 598 4.0E-35
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 730 1298 5.0E-35
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 373 593 5.0E-35
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 353 593 5.0E-35
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 27 598 5.0E-35
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 393 1287 5.0E-35
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 863 1299 6.0E-35
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 742 1292 7.0E-35
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 1056 1299 7.0E-35
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 863 1299 7.0E-35
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 805 1294 8.0E-35
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 1068 1292 8.0E-35
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1056 1299 8.0E-35
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1056 1299 8.0E-35
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1056 1299 8.0E-35
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 818 1282 1.0E-34
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 50 593 1.0E-34
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 170 598 1.0E-34
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 367 593 1.0E-34
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 50 593 1.0E-34
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 726 1292 2.0E-34
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 726 1292 2.0E-34
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 726 1292 2.0E-34
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 853 1289 2.0E-34
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1028 1296 2.0E-34
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1028 1296 2.0E-34
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 375 598 2.0E-34
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 375 598 2.0E-34
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 375 598 2.0E-34
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 360 593 2.0E-34
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 730 1298 3.0E-34
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 818 1282 3.0E-34
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 373 598 3.0E-34
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 800 1292 4.0E-34
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 812 1292 4.0E-34
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 890 1287 4.0E-34
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 368 602 4.0E-34
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 831 1287 5.0E-34
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 129 602 5.0E-34
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 374 585 5.0E-34
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 898 1292 6.0E-34
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1074 1292 8.0E-34
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 294 598 8.0E-34
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 226 585 9.0E-34
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 729 1292 1.0E-33
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 923 1293 1.0E-33
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 129 602 1.0E-33
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 129 602 1.0E-33
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 189 593 1.0E-33
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 923 1293 2.0E-33
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1071 1292 2.0E-33
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 373 593 2.0E-33
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 226 585 2.0E-33
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 129 602 3.0E-33
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 831 1303 4.0E-33
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 882 1292 4.0E-33
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 731 1294 4.0E-33
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 741 1292 4.0E-33
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 852 1292 4.0E-33
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 846 1292 4.0E-33
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 846 1292 4.0E-33
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 846 1292 4.0E-33
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 357 602 4.0E-33
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 357 602 4.0E-33
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 299 598 4.0E-33
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 54 593 4.0E-33
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 731 1294 5.0E-33
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 731 1294 5.0E-33
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 798 1283 5.0E-33
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 760 1292 6.0E-33
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 760 1292 6.0E-33
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 760 1292 6.0E-33
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 775 1292 6.0E-33
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 1056 1291 6.0E-33
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 135 600 6.0E-33
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 800 1292 7.0E-33
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 800 1292 7.0E-33
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 800 1292 1.0E-32
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 800 1292 1.0E-32
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 800 1292 1.0E-32
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 800 1292 1.0E-32
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 898 1292 1.0E-32
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 876 1303 1.0E-32
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 876 1303 1.0E-32
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 703 1282 1.0E-32
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 796 1283 1.0E-32
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 880 1292 2.0E-32
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 1056 1297 2.0E-32
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 800 1294 2.0E-32
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 368 598 2.0E-32
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 878 1292 2.0E-32
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 878 1292 2.0E-32
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 373 593 2.0E-32
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 300 598 2.0E-32
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 373 593 2.0E-32
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 792 1292 3.0E-32
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 743 1292 3.0E-32
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 196 602 3.0E-32
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 196 602 3.0E-32
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 372 570 3.0E-32
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 54 593 3.0E-32
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 1056 1299 5.0E-32
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 16 585 5.0E-32
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 367 598 5.0E-32
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 263 598 6.0E-32
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 804 1277 1.0E-31
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 732 1292 1.0E-31
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1072 1289 1.0E-31
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 800 1292 2.0E-31
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 800 1292 2.0E-31
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 800 1292 2.0E-31
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1072 1289 2.0E-31
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 1072 1289 2.0E-31
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 1072 1289 2.0E-31
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 831 1284 2.0E-31
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 739 1292 2.0E-31
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 818 1285 2.0E-31
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1071 1276 2.0E-31
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 1071 1292 3.0E-31
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 784 1292 3.0E-31
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 910 1292 3.0E-31
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 933 1277 3.0E-31
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 367 598 3.0E-31
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 179 593 3.0E-31
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 811 1303 4.0E-31
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1072 1297 4.0E-31
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 941 1295 4.0E-31
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 925 1301 4.0E-31
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 925 1301 4.0E-31
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 910 1292 4.0E-31
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 798 1292 4.0E-31
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 350 598 4.0E-31
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 33 598 4.0E-31
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 800 1292 5.0E-31
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 811 1303 5.0E-31
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 1072 1292 6.0E-31
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 1072 1292 6.0E-31
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 800 1292 6.0E-31
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 131 598 6.0E-31
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 131 598 6.0E-31
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 131 598 6.0E-31
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 749 1297 6.0E-31
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 373 598 6.0E-31
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 898 1297 7.0E-31
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 1072 1292 8.0E-31
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 831 1284 8.0E-31
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1070 1277 8.0E-31
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 800 1292 9.0E-31
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 727 1300 1.0E-30
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 811 1303 1.0E-30
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 811 1303 1.0E-30
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 818 1285 1.0E-30
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 715 1292 1.0E-30
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 998 1296 1.0E-30
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 108 586 1.0E-30
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1072 1302 1.0E-30
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 898 1292 2.0E-30
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 898 1292 2.0E-30
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 898 1292 2.0E-30
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 898 1292 2.0E-30
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 898 1292 2.0E-30
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 796 1292 2.0E-30
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 784 1292 2.0E-30
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 800 1292 3.0E-30
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 732 1299 3.0E-30
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 742 1296 5.0E-30
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 742 1296 5.0E-30
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 1072 1293 5.0E-30
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 271 586 5.0E-30
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 1074 1292 6.0E-30
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 784 1292 6.0E-30
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 901 1301 8.0E-30
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 760 1294 9.0E-30
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 696 1293 9.0E-30
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 793 1285 9.0E-30
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 863 1289 1.0E-29
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 1051 1296 1.0E-29
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 1051 1296 1.0E-29
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1072 1301 1.0E-29
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1072 1306 1.0E-29
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 1032 1297 1.0E-29
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1072 1302 1.0E-29
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1072 1287 1.0E-29
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 190 593 1.0E-29
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 1051 1292 2.0E-29
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 727 1294 2.0E-29
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 1072 1293 2.0E-29
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 721 1289 2.0E-29
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 998 1296 2.0E-29
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 998 1296 2.0E-29
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 998 1296 2.0E-29
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 799 1300 3.0E-29
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 818 1287 3.0E-29
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 699 1289 3.0E-29
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 1072 1292 3.0E-29
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 741 1287 3.0E-29
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 296 598 3.0E-29
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 748 1287 4.0E-29
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 742 1287 4.0E-29
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1072 1297 4.0E-29
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 898 1292 5.0E-29
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 789 1292 5.0E-29
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 924 1292 5.0E-29
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 738 1287 5.0E-29
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1072 1292 5.0E-29
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 398 1289 5.0E-29
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 733 1292 6.0E-29
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 375 598 6.0E-29
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 375 598 6.0E-29
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 375 598 6.0E-29
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 131 606 6.0E-29
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 1074 1283 9.0E-29
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1074 1292 9.0E-29
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1074 1283 1.0E-28
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 1074 1301 1.0E-28
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 875 1292 1.0E-28
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 875 1292 1.0E-28
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 373 598 1.0E-28
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 373 598 1.0E-28
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 1079 1292 2.0E-28
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 1076 1292 2.0E-28
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 1072 1292 2.0E-28
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 831 1287 2.0E-28
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 831 1287 2.0E-28
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 831 1287 2.0E-28
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 1076 1292 3.0E-28
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 817 1283 3.0E-28
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 377 598 3.0E-28
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 738 1289 4.0E-28
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 800 1293 6.0E-28
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 299 598 8.0E-28
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 861 1283 8.0E-28
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1072 1287 1.0E-27
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 733 1292 1.0E-27
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1063 1292 1.0E-27
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 899 1295 1.0E-27
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1072 1294 1.0E-27
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 129 598 1.0E-27
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 861 1283 1.0E-27
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 129 598 1.0E-27
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 861 1283 1.0E-27
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 129 598 1.0E-27
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1072 1306 1.0E-27
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1033 1305 3.0E-27
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 1072 1292 3.0E-27
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 195 606 3.0E-27
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 745 1289 4.0E-27
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1072 1292 4.0E-27
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 332 601 4.0E-27
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 819 1287 4.0E-27
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 1054 1301 5.0E-27
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 998 1293 6.0E-27
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 998 1293 6.0E-27
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 338 593 7.0E-27
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 886 1292 8.0E-27
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 898 1292 9.0E-27
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 1072 1294 1.0E-26
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 823 1289 1.0E-26
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1072 1293 1.0E-26
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1072 1308 1.0E-26
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 1072 1292 1.0E-26
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 412 598 1.0E-26
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 768 1292 2.0E-26
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1055 1301 2.0E-26
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 1072 1294 3.0E-26
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 899 1297 3.0E-26
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 876 1294 3.0E-26
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 106 598 3.0E-26
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1072 1290 4.0E-26
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 757 1293 5.0E-26
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 757 1293 5.0E-26
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 332 598 5.0E-26
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 941 1302 7.0E-26
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 819 1287 2.0E-25
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 819 1287 2.0E-25
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 819 1287 2.0E-25
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1018 1293 2.0E-25
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 882 1295 2.0E-25
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1063 1292 3.0E-25
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 876 1294 3.0E-25
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 831 1290 3.0E-25
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 1072 1308 4.0E-25
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1082 1295 5.0E-25
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 903 1297 5.0E-25
sp|Q8SQI5|ABC1_ENCCU Probable ABC transporter ECU01_0200/ECU01_1410 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0200 PE=3 SV=1 375 601 6.0E-25
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 1075 1297 1.0E-24
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 832 1282 2.0E-24
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1072 1292 2.0E-24
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1069 1277 2.0E-24
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1072 1292 2.0E-24
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 886 1292 2.0E-24
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 1057 1295 2.0E-24
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 876 1292 4.0E-24
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1072 1293 6.0E-24
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1072 1293 6.0E-24
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1072 1290 6.0E-24
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 1032 1271 7.0E-24
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1072 1290 8.0E-24
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 795 1294 8.0E-24
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 839 1299 9.0E-24
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1072 1293 2.0E-23
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 125 589 2.0E-23
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 390 606 2.0E-23
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1071 1293 3.0E-23
sp|Q82MV1|SSUB1_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB1 PE=3 SV=1 1088 1282 3.0E-23
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 373 593 4.0E-23
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 1072 1295 4.0E-23
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 373 584 7.0E-23
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1072 1286 7.0E-23
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 390 606 7.0E-23
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 373 589 8.0E-23
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 1075 1271 1.0E-22
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 831 1297 1.0E-22
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 353 598 1.0E-22
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 373 589 1.0E-22
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 129 589 1.0E-22
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1072 1293 2.0E-22
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 1076 1293 2.0E-22
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 357 598 2.0E-22
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 1076 1293 3.0E-22
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1084 1295 3.0E-22
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 1088 1284 3.0E-22
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1108 1303 4.0E-22
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 1076 1293 4.0E-22
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 1085 1277 4.0E-22
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 795 1284 4.0E-22
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 757 1285 4.0E-22
sp|Q4K441|SSUB2_PSEF5 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ssuB2 PE=3 SV=1 389 589 4.0E-22
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 134 589 4.0E-22
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1084 1295 5.0E-22
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 373 589 5.0E-22
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1076 1293 5.0E-22
sp|Q1IGL4|SSUB_PSEE4 Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas entomophila (strain L48) GN=ssuB PE=3 SV=1 390 589 5.0E-22
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 373 601 5.0E-22
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1084 1295 6.0E-22
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1086 1301 6.0E-22
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1067 1283 8.0E-22
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 385 598 8.0E-22
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 372 598 8.0E-22
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1076 1293 8.0E-22
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 1087 1282 8.0E-22
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 372 598 1.0E-21
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 1082 1286 2.0E-21
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 372 598 2.0E-21
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 397 603 2.0E-21
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 1072 1296 2.0E-21
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 389 589 2.0E-21
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1087 1302 2.0E-21
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 896 1285 3.0E-21
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 1076 1305 3.0E-21
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 375 598 3.0E-21
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 375 598 3.0E-21
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 1070 1266 3.0E-21
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 372 598 3.0E-21
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 373 590 3.0E-21
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1059 1304 4.0E-21
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1059 1304 4.0E-21
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1059 1304 4.0E-21
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 866 1294 4.0E-21
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1084 1295 4.0E-21
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 373 585 4.0E-21
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 1089 1282 4.0E-21
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 1089 1282 4.0E-21
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 360 598 5.0E-21
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 1085 1285 5.0E-21
sp|Q8CRI6|ECFA1_STAES Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA1 PE=3 SV=1 375 598 5.0E-21
sp|Q5HM27|ECFA1_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA1 PE=3 SV=1 375 598 5.0E-21
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 373 589 5.0E-21
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1076 1294 6.0E-21
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 114 589 6.0E-21
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 1092 1282 6.0E-21
sp|Q81GC1|POTA_BACCR Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1 1088 1289 7.0E-21
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 818 1294 8.0E-21
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 373 590 9.0E-21
sp|Q4ZLS1|SSUB3_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB3 PE=3 SV=1 389 589 9.0E-21
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 393 616 9.0E-21
sp|Q7A470|ECFA1_STAAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain N315) GN=ecfA1 PE=3 SV=1 375 600 9.0E-21
sp|Q99S47|ECFA1_STAAM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA1 PE=3 SV=1 375 600 9.0E-21
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 373 591 1.0E-20
sp|Q6GEL3|ECFA1_STAAR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1 375 600 1.0E-20
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 373 590 1.0E-20
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 373 593 1.0E-20
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 373 591 1.0E-20
sp|Q5HDY6|ECFA1_STAAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1 375 600 1.0E-20
sp|Q2FW34|ECFA1_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1 375 600 1.0E-20
sp|Q2FER7|ECFA1_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1 375 600 1.0E-20
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 1092 1282 1.0E-20
sp|Q5WET8|PSTB1_BACSK Phosphate import ATP-binding protein PstB 1 OS=Bacillus clausii (strain KSM-K16) GN=pstB1 PE=3 SV=1 1089 1280 1.0E-20
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 390 589 1.0E-20
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 1076 1295 1.0E-20
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 371 593 2.0E-20
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 118 598 2.0E-20
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 373 591 2.0E-20
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 375 598 2.0E-20
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 373 585 2.0E-20
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 373 590 2.0E-20
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 373 590 2.0E-20
sp|Q2YYM4|ECFA1_STAAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA1 PE=3 SV=2 375 593 2.0E-20
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 373 586 2.0E-20
sp|Q8NVB5|ECFA1_STAAW Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MW2) GN=ecfA1 PE=3 SV=1 375 593 2.0E-20
sp|Q6G799|ECFA1_STAAS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA1 PE=3 SV=1 375 593 2.0E-20
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 37 556 2.0E-20
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 373 589 2.0E-20
sp|Q92UV5|FBPC2_RHIME Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhizobium meliloti (strain 1021) GN=fbpC2 PE=3 SV=1 1080 1284 2.0E-20
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 380 590 2.0E-20
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 373 591 3.0E-20
sp|Q9HYG4|SSUB1_PSEAE Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ssuB1 PE=3 SV=1 390 589 3.0E-20
sp|Q6MMH0|PSTB_BDEBA Phosphate import ATP-binding protein PstB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pstB PE=3 SV=1 1076 1277 3.0E-20
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 389 593 3.0E-20
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 1076 1282 3.0E-20
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 1076 1282 3.0E-20
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 1076 1282 3.0E-20
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 1076 1285 3.0E-20
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 1076 1285 3.0E-20
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 1057 1271 3.0E-20
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 1076 1282 3.0E-20
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 1076 1266 3.0E-20
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 304 593 4.0E-20
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 1076 1293 4.0E-20
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 1089 1282 4.0E-20
sp|Q87UI3|SSUB3_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB3 PE=3 SV=1 390 589 4.0E-20
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 1092 1277 4.0E-20
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 373 590 5.0E-20
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 371 593 5.0E-20
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 352 590 5.0E-20
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 1092 1282 5.0E-20
sp|Q6D2D5|PSTB1_PECAS Phosphate import ATP-binding protein PstB 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pstB1 PE=3 SV=1 1053 1282 5.0E-20
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 375 583 5.0E-20
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 1076 1285 5.0E-20
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 373 589 5.0E-20
sp|Q6HLQ9|POTA_BACHK Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2 1088 1289 5.0E-20
sp|Q63E84|POTA_BACCZ Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2 1088 1289 5.0E-20
sp|Q73BM0|POTA_BACC1 Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1 1088 1289 5.0E-20
sp|A0RBB0|POTA_BACAH Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1 1088 1289 5.0E-20
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 1072 1285 5.0E-20
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 373 589 5.0E-20
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 1088 1282 5.0E-20
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 408 590 6.0E-20
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 373 585 6.0E-20
sp|Q5H002|PSTB_XANOR Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pstB PE=3 SV=2 1076 1278 7.0E-20
sp|Q2P2Y5|PSTB_XANOM Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pstB PE=3 SV=1 1076 1278 7.0E-20
sp|D4GSY7|ANTRA_HALVD Probable anion import ATP-binding protein HVO_1886 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_1886 PE=3 SV=1 1088 1277 7.0E-20
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 390 591 7.0E-20
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 1067 1282 8.0E-20
sp|Q0BUR6|SSUB_GRABC Aliphatic sulfonates import ATP-binding protein SsuB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ssuB PE=3 SV=1 1088 1276 8.0E-20
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 1076 1295 8.0E-20
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 1074 1273 8.0E-20
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 790 1283 9.0E-20
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 373 590 9.0E-20
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 372 590 9.0E-20
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 1084 1282 9.0E-20
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 1071 1277 9.0E-20
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 373 585 1.0E-19
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1072 1275 1.0E-19
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 273 590 1.0E-19
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 375 597 1.0E-19
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 858 1286 1.0E-19
sp|Q8YCG3|FBPC_BRUME Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1 1089 1282 1.0E-19
sp|Q1RDS4|SSUB_ECOUT Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli (strain UTI89 / UPEC) GN=ssuB PE=3 SV=1 380 591 1.0E-19
sp|A1A9L0|SSUB_ECOK1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O1:K1 / APEC GN=ssuB PE=3 SV=1 380 591 1.0E-19
sp|Q8FJ95|SSUB_ECOL6 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ssuB PE=3 SV=1 380 591 1.0E-19
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 1089 1277 1.0E-19
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 1088 1282 1.0E-19
sp|Q81TH8|POTA_BACAN Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus anthracis GN=potA PE=3 SV=2 1088 1289 1.0E-19
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 939 1277 1.0E-19
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 1076 1285 1.0E-19
sp|Q02QT1|SSUB2_PSEAB Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ssuB2 PE=3 SV=1 390 589 1.0E-19
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 353 590 1.0E-19
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 1078 1277 1.0E-19
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 373 589 1.0E-19
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1069 1292 2.0E-19
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 1086 1273 2.0E-19
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1089 1293 2.0E-19
sp|Q12R52|HMUV_SHEDO Hemin import ATP-binding protein HmuV OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hmuV PE=3 SV=1 1085 1285 2.0E-19
sp|Q87C88|PSTB_XYLFT Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pstB PE=3 SV=1 1067 1282 2.0E-19
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 373 589 2.0E-19
sp|Q4ZQE3|SSUB2_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB2 PE=3 SV=1 1071 1285 2.0E-19
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 196 593 2.0E-19
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 1093 1305 2.0E-19
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 1074 1284 3.0E-19
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 1088 1284 3.0E-19
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 1088 1282 3.0E-19
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 1072 1277 3.0E-19
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 1088 1289 3.0E-19
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 1070 1285 3.0E-19
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 1085 1301 3.0E-19
sp|Q0BTP1|PSTB_GRABC Phosphate import ATP-binding protein PstB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pstB PE=3 SV=1 1076 1282 3.0E-19
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 810 1239 4.0E-19
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 391 592 4.0E-19
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 1088 1282 4.0E-19
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 1056 1282 4.0E-19
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 1088 1282 4.0E-19
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 100 590 5.0E-19
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 903 1292 5.0E-19
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 393 600 6.0E-19
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 1133 1270 1.0E-18
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 903 1287 1.0E-18
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 392 602 1.0E-18
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 903 1287 2.0E-18
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 939 1277 2.0E-18
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 1072 1275 3.0E-18
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 1076 1298 3.0E-18
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1072 1289 4.0E-18
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 120 585 4.0E-18
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 900 1287 4.0E-18
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 375 570 4.0E-18
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 352 590 4.0E-18
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 393 600 5.0E-18
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 363 590 5.0E-18
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1070 1293 5.0E-18
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 373 590 6.0E-18
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 903 1289 9.0E-18
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1087 1293 9.0E-18
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1059 1289 1.0E-17
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1061 1285 1.0E-17
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1061 1285 1.0E-17
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 1060 1294 2.0E-17
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 388 601 2.0E-17
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 903 1287 2.0E-17
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 393 598 2.0E-17
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 367 694 2.0E-17
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1061 1285 2.0E-17
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1072 1297 2.0E-17
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1072 1297 2.0E-17
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 349 597 2.0E-17
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 373 572 3.0E-17
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 1088 1273 3.0E-17
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 371 647 3.0E-17
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 1072 1285 5.0E-17
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 384 598 6.0E-17
sp|Q87C88|PSTB_XYLFT Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pstB PE=3 SV=1 391 572 6.0E-17
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 393 598 7.0E-17
sp|Q87UI3|SSUB3_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB3 PE=3 SV=1 1067 1273 8.0E-17
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 397 598 1.0E-16
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 380 570 1.0E-16
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 1072 1297 1.0E-16
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1089 1285 1.0E-16
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 1067 1273 1.0E-16
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1081 1279 1.0E-16
sp|Q8YCG3|FBPC_BRUME Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1 373 600 1.0E-16
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 894 1291 2.0E-16
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 1067 1273 2.0E-16
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 373 600 2.0E-16
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 373 600 2.0E-16
sp|Q4ZLS1|SSUB3_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB3 PE=3 SV=1 1067 1273 2.0E-16
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 929 1283 2.0E-16
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 373 589 2.0E-16
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 392 602 3.0E-16
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 350 589 3.0E-16
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 1072 1291 3.0E-16
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 375 572 3.0E-16
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1072 1287 4.0E-16
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 373 598 4.0E-16
sp|Q1IGL4|SSUB_PSEE4 Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas entomophila (strain L48) GN=ssuB PE=3 SV=1 1067 1273 4.0E-16
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 348 598 4.0E-16
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 393 602 4.0E-16
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1040 1287 4.0E-16
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 379 573 4.0E-16
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 379 573 4.0E-16
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 386 598 5.0E-16
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 386 600 5.0E-16
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 1040 1287 5.0E-16
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 391 572 5.0E-16
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1072 1290 6.0E-16
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 375 572 6.0E-16
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 393 593 7.0E-16
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1040 1287 7.0E-16
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 1076 1285 8.0E-16
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 373 598 8.0E-16
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 397 600 9.0E-16
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 393 572 1.0E-15
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 393 572 1.0E-15
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 994 1302 1.0E-15
sp|Q5H002|PSTB_XANOR Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pstB PE=3 SV=2 379 572 1.0E-15
sp|Q2P2Y5|PSTB_XANOM Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pstB PE=3 SV=1 379 572 1.0E-15
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 373 598 2.0E-15
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1072 1287 2.0E-15
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 373 585 2.0E-15
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 397 600 2.0E-15
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 375 623 2.0E-15
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 373 600 3.0E-15
sp|Q0BTP1|PSTB_GRABC Phosphate import ATP-binding protein PstB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pstB PE=3 SV=1 379 583 3.0E-15
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 1088 1274 3.0E-15
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 1094 1292 4.0E-15
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1072 1287 4.0E-15
sp|Q8SQI5|ABC1_ENCCU Probable ABC transporter ECU01_0200/ECU01_1410 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0200 PE=3 SV=1 1072 1283 4.0E-15
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 392 598 4.0E-15
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 349 616 6.0E-15
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 1088 1273 6.0E-15
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 373 589 6.0E-15
sp|Q4K441|SSUB2_PSEF5 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ssuB2 PE=3 SV=1 1059 1273 6.0E-15
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 401 626 6.0E-15
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 1088 1273 7.0E-15
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 1072 1287 8.0E-15
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1072 1287 8.0E-15
sp|Q6MMH0|PSTB_BDEBA Phosphate import ATP-binding protein PstB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pstB PE=3 SV=1 390 570 8.0E-15
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1082 1299 8.0E-15
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 373 589 8.0E-15
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 358 593 9.0E-15
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 381 598 1.0E-14
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 393 593 1.0E-14
sp|Q9HYG4|SSUB1_PSEAE Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ssuB1 PE=3 SV=1 1055 1273 1.0E-14
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 997 1282 1.0E-14
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 375 600 2.0E-14
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 355 671 2.0E-14
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 381 598 3.0E-14
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 381 598 3.0E-14
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 382 602 3.0E-14
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 392 589 3.0E-14
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1088 1291 3.0E-14
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 1089 1291 3.0E-14
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1072 1294 4.0E-14
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 360 593 4.0E-14
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1072 1293 4.0E-14
sp|Q02QT1|SSUB2_PSEAB Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ssuB2 PE=3 SV=1 1055 1273 4.0E-14
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1074 1289 5.0E-14
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 1092 1282 5.0E-14
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 373 589 6.0E-14
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1072 1271 6.0E-14
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1072 1289 6.0E-14
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 382 613 7.0E-14
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1079 1297 8.0E-14
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1062 1282 9.0E-14
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 389 598 9.0E-14
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 373 585 9.0E-14
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 373 589 1.0E-13
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 382 598 1.0E-13
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1072 1293 1.0E-13
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 390 630 1.0E-13
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 382 613 1.0E-13
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 390 632 1.0E-13
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 374 598 1.0E-13
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 370 600 2.0E-13
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1072 1293 2.0E-13
sp|Q6D2D5|PSTB1_PECAS Phosphate import ATP-binding protein PstB 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pstB1 PE=3 SV=1 390 573 2.0E-13
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 403 625 2.0E-13
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 375 593 3.0E-13
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 1074 1275 3.0E-13
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1072 1293 4.0E-13
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1088 1299 4.0E-13
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 381 602 5.0E-13
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1072 1293 5.0E-13
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1089 1299 6.0E-13
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 375 593 7.0E-13
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1072 1275 7.0E-13
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1074 1275 7.0E-13
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1072 1288 7.0E-13
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 1070 1293 7.0E-13
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 379 628 8.0E-13
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 391 598 9.0E-13
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 393 593 9.0E-13
sp|Q5WET8|PSTB1_BACSK Phosphate import ATP-binding protein PstB 1 OS=Bacillus clausii (strain KSM-K16) GN=pstB1 PE=3 SV=1 379 572 1.0E-12
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 375 571 1.0E-12
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 386 571 1.0E-12
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 203 629 2.0E-12
sp|Q82MV1|SSUB1_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB1 PE=3 SV=1 390 621 2.0E-12
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 201 634 2.0E-12
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 1072 1271 2.0E-12
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 392 600 2.0E-12
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 392 600 2.0E-12
sp|Q81GC1|POTA_BACCR Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1 392 614 3.0E-12
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1061 1275 3.0E-12
sp|Q1RDS4|SSUB_ECOUT Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli (strain UTI89 / UPEC) GN=ssuB PE=3 SV=1 1088 1273 3.0E-12
sp|A1A9L0|SSUB_ECOK1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O1:K1 / APEC GN=ssuB PE=3 SV=1 1088 1273 3.0E-12
sp|Q8FJ95|SSUB_ECOL6 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ssuB PE=3 SV=1 1088 1273 3.0E-12
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1076 1294 4.0E-12
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 1072 1285 4.0E-12
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1072 1285 5.0E-12
sp|Q6HLQ9|POTA_BACHK Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2 392 614 5.0E-12
sp|Q63E84|POTA_BACCZ Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2 392 614 5.0E-12
sp|Q73BM0|POTA_BACC1 Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1 392 614 5.0E-12
sp|A0RBB0|POTA_BACAH Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1 392 614 5.0E-12
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 678 1291 5.0E-12
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 374 600 6.0E-12
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 400 630 6.0E-12
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 1074 1275 9.0E-12
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1072 1285 1.0E-11
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1072 1285 1.0E-11
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 367 600 1.0E-11
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 393 598 1.0E-11
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 1072 1301 1.0E-11
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 348 602 1.0E-11
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 393 593 1.0E-11
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 392 598 1.0E-11
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 1072 1301 2.0E-11
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 393 598 2.0E-11
sp|Q8CRI6|ECFA1_STAES Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA1 PE=3 SV=1 1072 1289 2.0E-11
sp|Q5HM27|ECFA1_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA1 PE=3 SV=1 1072 1289 2.0E-11
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 387 593 2.0E-11
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 385 585 2.0E-11
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 375 587 2.0E-11
sp|Q81TH8|POTA_BACAN Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus anthracis GN=potA PE=3 SV=2 392 614 2.0E-11
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 870 1292 3.0E-11
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1088 1294 3.0E-11
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 393 598 4.0E-11
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 375 572 4.0E-11
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 377 600 4.0E-11
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1066 1294 5.0E-11
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1066 1294 5.0E-11
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 356 589 6.0E-11
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 373 594 6.0E-11
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 900 1292 8.0E-11
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 1098 1286 9.0E-11
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 857 1301 1.0E-10
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 1081 1275 2.0E-10
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 360 593 3.0E-10
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 375 602 3.0E-10
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 393 570 5.0E-10
sp|Q0BUR6|SSUB_GRABC Aliphatic sulfonates import ATP-binding protein SsuB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ssuB PE=3 SV=1 392 592 5.0E-10
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 900 1292 7.0E-10
sp|Q5HDY6|ECFA1_STAAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1 1074 1292 7.0E-10
sp|Q2FW34|ECFA1_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1 1074 1292 7.0E-10
sp|Q2FER7|ECFA1_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1 1074 1292 7.0E-10
sp|D4GSY7|ANTRA_HALVD Probable anion import ATP-binding protein HVO_1886 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_1886 PE=3 SV=1 392 572 9.0E-10
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 903 1286 1.0E-09
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 392 593 2.0E-09
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 392 593 3.0E-09
sp|Q92UV5|FBPC2_RHIME Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhizobium meliloti (strain 1021) GN=fbpC2 PE=3 SV=1 403 614 3.0E-09
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 391 571 3.0E-09
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 391 571 3.0E-09
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 391 571 3.0E-09
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 289 602 6.0E-09
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 289 602 6.0E-09
sp|Q4ZQE3|SSUB2_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB2 PE=3 SV=1 390 598 7.0E-09
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 391 571 9.0E-09
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1088 1304 2.0E-08
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 430 602 4.0E-08
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 376 552 2.0E-07
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1074 1275 3.0E-07
sp|Q12R52|HMUV_SHEDO Hemin import ATP-binding protein HmuV OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hmuV PE=3 SV=1 390 593 3.0E-07
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 1075 1254 4.0E-07
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 1072 1275 6.0E-07
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 391 598 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0006810 transport No
GO:0032555 purine ribonucleotide binding No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 101 123 22
3 174 196 22
4 200 217 17
5 282 304 22
6 756 778 22
7 798 820 22
8 874 896 22
9 981 1003 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 18.91 10.35 27.47
CcL In ants, during behavior modification 13.60 7.15 20.05
CcD In ants, recently dead 13.42 7.06 19.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.160585 no
SC16a CcD 0.144151 no
CcL CcD 0.964294 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4076
MKPRDSESIVTATDVSLMLSKPLPPLPQQSKTSWRSLFAFTARGHSHVLLGAVLASLAVAALQTILAIILGRIFE
IVAGLGNGVQSGHEALEAVSRWCLVLLGLGFANWFSNSVFLGLWVAFGEMQADAGRRRVFESLLAKDMAWFDRLE
QGMSGLLSRIQTQTRELQSATAQVLGFLVCDMLVSCASLTVAMFYSWKLTLVLLATLPPSIMALSLATRQLDSAI
QSQKACLERATKLARASLAAIDVVKVFNGSNRELRQYRDALGLARAHYLVQARCNSVQMGYIAFWVVSLFIIGFW
YGVVLVRDGLSPGHVVTTFYSTLAAFQAAEALGSNWLILSKGVAAGSFLSGIVQDEKPVEADGRRFRLEHCVGDV
QFTDVSFAYPSNPAKKVLEQASFTFPAGQTTFVVGKSGCGKSTVGSLLANFYQPLSGNILIDGQPLEQFDASWVR
ENITLIQQESLLFRDSLYNNVTLGKPNACKEEVLAACQAALLQSTVASLPRGLETEVGPGGVALSGGQKQKVALA
RAYLKNSTILVLDEVTSDLDQVSRSLVMDAIRQWRRDKTTIIVTHDVSCIDGDDYVYVMDDATVACQGFKRDLND
LGWPKAATEIDNNPPADSVNPPDRSAPRSSMGGSLLSPLRTGHRMSLRISPARALFPDRGVRPLTSLDDPGSNIN
IHNSSIDGDDDNDDGSPLFVFGAAERRKGISILRQAACQQRPTTAAEEGEGQQDRSQPKHASLLSILGTIWPRLK
AKERLTLILGLIICSVAATATPAFAFCLSRLMSVMWSSGDKLVQGRQWALLLTGVAITDGLCTGLGRYLLELVAQ
SWTDGIRTQAMASILKQKRPWFDGVKHAPSRLAECLERNAEEMRNVVGRFLAILVFVSVIMTLSILWALVVDWRL
SLVALAPLPLTLAAVRGYATVSGEWERRCNDAAEESSAMATETLIGIRLVRALDLSARQTTRYQTSAIRTRSLGM
ARARRTSCIFGLYQSMGYALSALVFYYGTRRLTSATVDVAAVLHVITLLLFAIGTSSEMLDGLPQLTLAQAAAGP
LLDYAALPKPRRRLQQLVSLPLRFHNLVFSYPASREPILGGLSLEIRPGESIAIVGPSGCGKSTLLSLILGLYPP
TRPALGTALVPQSPTVFPATISENILYGLPSNSPLRKAGSLEAASQAAGVHAFASSLPQGYATPVGDGGQTLSGG
QAQRLAIARALVRCPQLLVMDEPTSALDAESAKRVRHAMRVVAGLGAAVVVATHCPYMMRAADRVVVLGRGVVVE
QGRFQDLVRKGGALSHLVSGGQWNGERAAGDCS
Coding >Ophio5|4076
ATGAAGCCCAGAGACTCGGAATCCATCGTCACAGCCACTGACGTCTCTTTGATGCTTTCGAAACCTCTTCCCCCG
CTGCCTCAACAATCCAAAACTTCATGGAGAAGCCTCTTCGCCTTCACGGCAAGAGGACACTCCCATGTGCTTCTC
GGTGCCGTCCTAGCATCCCTCGCCGTGGCCGCTCTTCAGACCATACTGGCCATCATCCTCGGTCGCATCTTCGAA
ATCGTTGCAGGACTGGGAAACGGAGTTCAGTCCGGGCATGAAGCTCTCGAGGCTGTGTCGCGATGGTGTTTGGTC
CTGCTCGGCCTCGGCTTTGCCAATTGGTTTTCCAACTCGGTCTTTCTTGGACTATGGGTTGCCTTTGGTGAGATG
CAGGCTGATGCCGGTCGTCGACGCGTCTTTGAAAGCTTGCTGGCCAAGGATATGGCCTGGTTCGACAGGTTGGAG
CAGGGCATGTCTGGTCTCTTGAGCAGGATTCAAACCCAGACGCGAGAGCTCCAATCAGCAACGGCGCAGGTTCTT
GGCTTTCTCGTCTGCGACATGCTGGTTTCGTGCGCCTCCCTGACGGTGGCCATGTTCTACTCGTGGAAGTTGACG
CTGGTGCTGCTCGCCACTCTGCCACCCTCCATTATGGCCCTCTCCCTCGCCACTCGACAACTGGATTCGGCGATT
CAGAGCCAAAAGGCTTGTCTTGAGCGGGCTACCAAGCTGGCCAGGGCGTCGCTCGCGGCCATCGACGTGGTCAAA
GTCTTCAATGGCTCCAACAGGGAGCTGCGACAATACCGCGACGCCCTCGGTCTGGCTAGAGCACACTATTTGGTT
CAGGCACGCTGTAACTCGGTGCAAATGGGCTATATTGCCTTTTGGGTCGTCTCCCTCTTCATCATTGGCTTCTGG
TACGGCGTCGTACTGGTCCGAGACGGGCTTTCTCCGGGACATGTGGTCACGACGTTTTACTCGACTCTGGCTGCT
TTCCAGGCCGCCGAGGCTCTGGGCTCCAACTGGCTGATCCTATCCAAGGGCGTGGCAGCAGGGAGCTTTCTGTCG
GGCATCGTCCAGGACGAGAAGCCAGTCGAGGCAGACGGTCGCCGGTTCCGACTGGAGCATTGCGTGGGAGACGTG
CAGTTTACAGACGTGAGCTTCGCGTATCCTTCGAACCCGGCCAAAAAGGTGCTGGAACAGGCCTCTTTTACCTTT
CCCGCCGGCCAAACGACCTTTGTCGTTGGCAAAAGCGGCTGCGGGAAGAGCACAGTCGGCAGTCTGTTGGCCAAC
TTCTACCAGCCCCTGAGTGGCAACATCCTCATCGACGGACAGCCCTTGGAACAGTTCGACGCCAGCTGGGTCCGC
GAGAACATTACCCTGATCCAGCAGGAGAGCCTCCTCTTCCGCGACTCGCTCTATAACAATGTGACTCTAGGGAAG
CCAAACGCGTGCAAGGAGGAAGTCCTGGCCGCCTGCCAAGCCGCGTTGCTGCAGTCGACGGTGGCCTCTCTGCCT
CGCGGCCTCGAGACCGAAGTTGGACCCGGAGGCGTCGCCCTCAGCGGCGGACAGAAGCAAAAGGTTGCTCTGGCG
AGAGCGTATCTGAAGAATTCGACGATTCTCGTGCTGGATGAGGTGACGAGCGACCTTGATCAGGTCAGTCGATCG
TTGGTCATGGACGCAATTCGGCAATGGAGGAGGGATAAGACGACCATCATCGTCACCCATGACGTGTCCTGCATC
GACGGAGACGATTACGTCTACGTTATGGACGATGCAACCGTCGCTTGTCAGGGCTTCAAGCGAGACCTCAACGAC
CTCGGCTGGCCCAAGGCAGCAACGGAAATCGACAACAACCCCCCGGCAGACAGCGTCAACCCCCCGGACCGATCA
GCACCCCGGTCTTCCATGGGCGGAAGCCTGCTCTCGCCTCTCCGAACAGGACATAGGATGTCGCTCCGGATCAGT
CCCGCGCGGGCCCTTTTCCCGGACAGAGGAGTCAGACCTCTCACAAGCCTCGACGATCCAGGCAGCAACATCAAC
ATCCACAACAGCAGCATCGACGGCGACGACGACAACGACGACGGCAGTCCCCTTTTCGTCTTCGGAGCAGCCGAG
CGAAGAAAAGGCATATCAATCCTACGACAAGCAGCTTGCCAACAACGCCCAACGACAGCAGCAGAAGAAGGAGAA
GGACAACAAGACAGGTCGCAGCCAAAACATGCCTCCCTCCTCTCCATCCTTGGAACCATCTGGCCAAGACTCAAG
GCAAAGGAGAGACTAACGCTCATCCTCGGCCTCATCATCTGCTCCGTCGCCGCCACAGCAACACCAGCTTTTGCA
TTCTGTCTCTCCCGACTCATGTCGGTAATGTGGTCTTCAGGCGACAAGCTCGTCCAAGGTCGTCAATGGGCTCTC
CTCCTTACCGGCGTCGCCATAACCGACGGCCTCTGCACAGGTCTAGGTCGCTATTTGCTCGAACTGGTGGCTCAG
TCCTGGACAGATGGTATCCGGACCCAAGCCATGGCCAGCATCTTGAAACAGAAGAGACCGTGGTTCGATGGCGTC
AAGCACGCGCCCAGTCGCCTGGCGGAATGTCTGGAGCGCAACGCCGAGGAGATGCGCAACGTCGTCGGTCGTTTC
CTTGCCATTCTCGTCTTCGTTTCCGTCATCATGACGCTTTCCATCCTTTGGGCCCTCGTCGTCGACTGGAGACTT
TCGCTCGTTGCTCTTGCGCCTTTGCCCTTGACCTTGGCTGCCGTCAGGGGTTATGCCACCGTTAGTGGCGAATGG
GAAAGGCGTTGTAATGACGCGGCCGAGGAATCTAGCGCCATGGCGACCGAGACGCTCATCGGCATTCGTCTCGTT
CGTGCTCTCGACCTTTCCGCTCGTCAGACGACTCGTTACCAAACCAGCGCCATCCGAACCCGTTCTCTCGGTATG
GCCCGTGCCAGGAGAACAAGTTGCATCTTCGGCCTCTATCAATCCATGGGCTACGCCTTATCCGCTCTCGTCTTT
TATTACGGCACTCGTCGACTGACGTCGGCAACCGTCGACGTCGCAGCCGTCTTACACGTCATCACTCTTCTGCTC
TTCGCCATAGGAACTTCCAGCGAGATGCTGGATGGTTTACCTCAGTTGACCTTGGCCCAGGCTGCTGCCGGACCT
TTACTCGACTACGCCGCACTGCCAAAACCGAGACGACGACTGCAACAGCTAGTCTCACTCCCTCTCCGTTTCCAC
AACCTCGTCTTCTCTTATCCCGCTAGTCGGGAGCCCATCCTTGGCGGCCTGTCGCTCGAGATCCGTCCAGGGGAG
AGCATCGCCATAGTCGGCCCTTCAGGCTGCGGCAAATCAACTCTTCTCTCCCTCATCCTAGGCCTCTACCCACCC
ACCAGACCAGCCCTGGGCACCGCCCTCGTCCCCCAATCGCCCACCGTCTTCCCGGCCACCATTTCCGAAAACATC
CTCTATGGCCTCCCTTCCAACTCGCCCCTACGCAAAGCCGGCTCGTTAGAAGCCGCCTCTCAAGCAGCAGGCGTA
CACGCCTTCGCCTCGTCGCTACCGCAAGGCTACGCCACGCCCGTCGGCGACGGTGGCCAGACATTATCCGGTGGC
CAGGCTCAGAGACTCGCCATCGCTCGAGCTCTCGTTCGTTGTCCGCAGCTGCTCGTCATGGATGAGCCGACGAGC
GCGCTTGACGCCGAGTCTGCCAAGAGGGTGCGTCACGCCATGAGGGTCGTGGCCGGTTTGGGCGCCGCTGTCGTC
GTCGCAACCCATTGTCCCTACATGATGCGAGCCGCTGATCGGGTCGTTGTTCTCGGTCGTGGCGTCGTCGTCGAG
CAAGGTCGCTTCCAGGATCTGGTTAGGAAAGGGGGGGCTCTCTCGCATCTTGTCTCCGGCGGACAGTGGAATGGG
GAGAGGGCCGCGGGGGATTGTTCA
Transcript >Ophio5|4076
ATGAAGCCCAGAGACTCGGAATCCATCGTCACAGCCACTGACGTCTCTTTGATGCTTTCGAAACCTCTTCCCCCG
CTGCCTCAACAATCCAAAACTTCATGGAGAAGCCTCTTCGCCTTCACGGCAAGAGGACACTCCCATGTGCTTCTC
GGTGCCGTCCTAGCATCCCTCGCCGTGGCCGCTCTTCAGACCATACTGGCCATCATCCTCGGTCGCATCTTCGAA
ATCGTTGCAGGACTGGGAAACGGAGTTCAGTCCGGGCATGAAGCTCTCGAGGCTGTGTCGCGATGGTGTTTGGTC
CTGCTCGGCCTCGGCTTTGCCAATTGGTTTTCCAACTCGGTCTTTCTTGGACTATGGGTTGCCTTTGGTGAGATG
CAGGCTGATGCCGGTCGTCGACGCGTCTTTGAAAGCTTGCTGGCCAAGGATATGGCCTGGTTCGACAGGTTGGAG
CAGGGCATGTCTGGTCTCTTGAGCAGGATTCAAACCCAGACGCGAGAGCTCCAATCAGCAACGGCGCAGGTTCTT
GGCTTTCTCGTCTGCGACATGCTGGTTTCGTGCGCCTCCCTGACGGTGGCCATGTTCTACTCGTGGAAGTTGACG
CTGGTGCTGCTCGCCACTCTGCCACCCTCCATTATGGCCCTCTCCCTCGCCACTCGACAACTGGATTCGGCGATT
CAGAGCCAAAAGGCTTGTCTTGAGCGGGCTACCAAGCTGGCCAGGGCGTCGCTCGCGGCCATCGACGTGGTCAAA
GTCTTCAATGGCTCCAACAGGGAGCTGCGACAATACCGCGACGCCCTCGGTCTGGCTAGAGCACACTATTTGGTT
CAGGCACGCTGTAACTCGGTGCAAATGGGCTATATTGCCTTTTGGGTCGTCTCCCTCTTCATCATTGGCTTCTGG
TACGGCGTCGTACTGGTCCGAGACGGGCTTTCTCCGGGACATGTGGTCACGACGTTTTACTCGACTCTGGCTGCT
TTCCAGGCCGCCGAGGCTCTGGGCTCCAACTGGCTGATCCTATCCAAGGGCGTGGCAGCAGGGAGCTTTCTGTCG
GGCATCGTCCAGGACGAGAAGCCAGTCGAGGCAGACGGTCGCCGGTTCCGACTGGAGCATTGCGTGGGAGACGTG
CAGTTTACAGACGTGAGCTTCGCGTATCCTTCGAACCCGGCCAAAAAGGTGCTGGAACAGGCCTCTTTTACCTTT
CCCGCCGGCCAAACGACCTTTGTCGTTGGCAAAAGCGGCTGCGGGAAGAGCACAGTCGGCAGTCTGTTGGCCAAC
TTCTACCAGCCCCTGAGTGGCAACATCCTCATCGACGGACAGCCCTTGGAACAGTTCGACGCCAGCTGGGTCCGC
GAGAACATTACCCTGATCCAGCAGGAGAGCCTCCTCTTCCGCGACTCGCTCTATAACAATGTGACTCTAGGGAAG
CCAAACGCGTGCAAGGAGGAAGTCCTGGCCGCCTGCCAAGCCGCGTTGCTGCAGTCGACGGTGGCCTCTCTGCCT
CGCGGCCTCGAGACCGAAGTTGGACCCGGAGGCGTCGCCCTCAGCGGCGGACAGAAGCAAAAGGTTGCTCTGGCG
AGAGCGTATCTGAAGAATTCGACGATTCTCGTGCTGGATGAGGTGACGAGCGACCTTGATCAGGTCAGTCGATCG
TTGGTCATGGACGCAATTCGGCAATGGAGGAGGGATAAGACGACCATCATCGTCACCCATGACGTGTCCTGCATC
GACGGAGACGATTACGTCTACGTTATGGACGATGCAACCGTCGCTTGTCAGGGCTTCAAGCGAGACCTCAACGAC
CTCGGCTGGCCCAAGGCAGCAACGGAAATCGACAACAACCCCCCGGCAGACAGCGTCAACCCCCCGGACCGATCA
GCACCCCGGTCTTCCATGGGCGGAAGCCTGCTCTCGCCTCTCCGAACAGGACATAGGATGTCGCTCCGGATCAGT
CCCGCGCGGGCCCTTTTCCCGGACAGAGGAGTCAGACCTCTCACAAGCCTCGACGATCCAGGCAGCAACATCAAC
ATCCACAACAGCAGCATCGACGGCGACGACGACAACGACGACGGCAGTCCCCTTTTCGTCTTCGGAGCAGCCGAG
CGAAGAAAAGGCATATCAATCCTACGACAAGCAGCTTGCCAACAACGCCCAACGACAGCAGCAGAAGAAGGAGAA
GGACAACAAGACAGGTCGCAGCCAAAACATGCCTCCCTCCTCTCCATCCTTGGAACCATCTGGCCAAGACTCAAG
GCAAAGGAGAGACTAACGCTCATCCTCGGCCTCATCATCTGCTCCGTCGCCGCCACAGCAACACCAGCTTTTGCA
TTCTGTCTCTCCCGACTCATGTCGGTAATGTGGTCTTCAGGCGACAAGCTCGTCCAAGGTCGTCAATGGGCTCTC
CTCCTTACCGGCGTCGCCATAACCGACGGCCTCTGCACAGGTCTAGGTCGCTATTTGCTCGAACTGGTGGCTCAG
TCCTGGACAGATGGTATCCGGACCCAAGCCATGGCCAGCATCTTGAAACAGAAGAGACCGTGGTTCGATGGCGTC
AAGCACGCGCCCAGTCGCCTGGCGGAATGTCTGGAGCGCAACGCCGAGGAGATGCGCAACGTCGTCGGTCGTTTC
CTTGCCATTCTCGTCTTCGTTTCCGTCATCATGACGCTTTCCATCCTTTGGGCCCTCGTCGTCGACTGGAGACTT
TCGCTCGTTGCTCTTGCGCCTTTGCCCTTGACCTTGGCTGCCGTCAGGGGTTATGCCACCGTTAGTGGCGAATGG
GAAAGGCGTTGTAATGACGCGGCCGAGGAATCTAGCGCCATGGCGACCGAGACGCTCATCGGCATTCGTCTCGTT
CGTGCTCTCGACCTTTCCGCTCGTCAGACGACTCGTTACCAAACCAGCGCCATCCGAACCCGTTCTCTCGGTATG
GCCCGTGCCAGGAGAACAAGTTGCATCTTCGGCCTCTATCAATCCATGGGCTACGCCTTATCCGCTCTCGTCTTT
TATTACGGCACTCGTCGACTGACGTCGGCAACCGTCGACGTCGCAGCCGTCTTACACGTCATCACTCTTCTGCTC
TTCGCCATAGGAACTTCCAGCGAGATGCTGGATGGTTTACCTCAGTTGACCTTGGCCCAGGCTGCTGCCGGACCT
TTACTCGACTACGCCGCACTGCCAAAACCGAGACGACGACTGCAACAGCTAGTCTCACTCCCTCTCCGTTTCCAC
AACCTCGTCTTCTCTTATCCCGCTAGTCGGGAGCCCATCCTTGGCGGCCTGTCGCTCGAGATCCGTCCAGGGGAG
AGCATCGCCATAGTCGGCCCTTCAGGCTGCGGCAAATCAACTCTTCTCTCCCTCATCCTAGGCCTCTACCCACCC
ACCAGACCAGCCCTGGGCACCGCCCTCGTCCCCCAATCGCCCACCGTCTTCCCGGCCACCATTTCCGAAAACATC
CTCTATGGCCTCCCTTCCAACTCGCCCCTACGCAAAGCCGGCTCGTTAGAAGCCGCCTCTCAAGCAGCAGGCGTA
CACGCCTTCGCCTCGTCGCTACCGCAAGGCTACGCCACGCCCGTCGGCGACGGTGGCCAGACATTATCCGGTGGC
CAGGCTCAGAGACTCGCCATCGCTCGAGCTCTCGTTCGTTGTCCGCAGCTGCTCGTCATGGATGAGCCGACGAGC
GCGCTTGACGCCGAGTCTGCCAAGAGGGTGCGTCACGCCATGAGGGTCGTGGCCGGTTTGGGCGCCGCTGTCGTC
GTCGCAACCCATTGTCCCTACATGATGCGAGCCGCTGATCGGGTCGTTGTTCTCGGTCGTGGCGTCGTCGTCGAG
CAAGGTCGCTTCCAGGATCTGGTTAGGAAAGGGGGGGCTCTCTCGCATCTTGTCTCCGGCGGACAGTGGAATGGG
GAGAGGGCCGCGGGGGATTGTTCATGA
Gene >Ophio5|4076
ATGAAGCCCAGAGACTCGGAATCCATCGTCACAGCCACTGACGTCTCTTTGATGCTTTCGAAACCTCTTCCCCCG
CTGCCTCAACAATCCAAAACTTCATGGAGAAGCCTCTTCGCCTTCACGGCAAGAGGACACTCCCATGTGCTTCTC
GGTGCCGTCCTAGCATCCCTCGCCGTGGCCGCTCTTCAGACCATACTGGCCATCATCCTCGGTCGCATCTTCGAA
ATCGTTGCAGGACTGGGAAACGGAGTTCAGTCCGGGCATGAAGCTCTCGAGGCTGTGTCGCGATGGTGTTTGGTC
CTGCTCGGCCTCGGCTTTGCCAATTGGTTTTCCAACTCGGTCTTTCTTGGACTATGGGTTGCCTTTGGTGAGATG
CAGGCTGATGCCGGTCGTCGACGCGTCTTTGAAAGCTTGCTGGCCAAGGATATGGCCTGGTTCGACAGGTTGGAG
CAGGGCATGTCTGGTCTCTTGAGCAGGATTCAAACGTACGTTCCTCCAATCTCTCCATTTCCCCTCCTTGGACAA
GCCGCTAATCGGTCTTGTCGAACAGCCAGACGCGAGAGCTCCAATCAGCAACGGCGCAGGTTCTTGGCTTTCTCG
TCTGCGACATGCTGGTTTCGTGCGCCTCCCTGACGGTGGCCATGTTCTACTCGTGGAAGTTGACGCTGGTGCTGC
TCGCCACTCTGCCACCCTCCATTATGGCCCTCTCCCTCGCCACTCGACAACTGGATTCGGCGATTCAGAGCCAAA
AGGCTTGTCTTGAGCGGGCTACCAAGCTGGCCAGGGCGTCGCTCGCGGCCATCGACGTGGTCAAAGTCTTCAATG
GCTCCAACAGGGAGCTGCGACAATACCGCGACGCCCTCGGTCTGGCTAGAGCACACTATTTGGTTCAGGCACGCT
GTAACTCGGTGCAAATGGGCTATATTGCCTTTTGGGTCGTCTCCCTCTTCATCATTGGCTTCTGGTACGGCGTCG
TACTGGTCCGAGACGGGCTTTCTCCGGGACATGTGGTCACGACGTTTTACTCGACTCTGGCTGCTTTCCAGGCCG
CCGAGGCTCTGGGCTCCAACTGGCTGATCCTATCCAAGGGCGTGGCAGCAGGGAGCTTTCTGTCGGGCATCGTCC
AGGACGAGAAGCCAGTCGAGGCAGACGGTCGCCGGTTCCGACTGGAGCATTGCGTGGGAGACGTGCAGTTTACAG
ACGTACGTCTTCCCCTTGACGGTGCTGTTCTTCTTTCGGCTGACCGAGATACCAGGTGAGCTTCGCGTATCCTTC
GAACCCGGCCAAAAAGGTGCTGGAACAGGCCTCTTTTACCTTTCCCGCCGGCCAAACGACCTTTGTCGTTGGCAA
AAGCGGCTGCGGGAAGAGCACAGTCGGCAGTCTGTTGGCCAACTTCTACCAGCCCCTGAGTGGCAACATCCTCAT
CGACGGACAGCCCTTGGAACAGTTCGACGCCAGCTGGGTCCGCGAGAACATTACCCTGATCCAGCAGGAGAGCCT
CCTCTTCCGCGACTCGCTCTATAACAATGTGACTCTAGGGAAGCCAAACGCGTGCAAGGAGGAAGTCCTGGCCGC
CTGCCAAGCCGCGTTGCTGCAGTCGACGGTGGCCTCTCTGCCTCGCGGCCTCGAGACCGAAGTTGGACCCGGAGG
CGTCGCCCTCAGCGGCGGACAGAAGCAAAAGGTTGCTCTGGCGAGAGCGTATCTGAAGAATTCGACGATTCTCGT
GCTGGATGAGGTGACGAGCGACCTTGATCAGGTCAGTCGATCGTTGGTCATGGACGCAATTCGGCAATGGAGGAG
GGATAAGACGACCATCATCGTCACCCATGACGTGTCCTGCATCGACGGAGACGATTACGTCTACGTTATGGACGA
TGCAACCGTCGCTTGTCAGGGCTTCAAGCGAGACCTCAACGACCTCGGCTGGCCCAAGGCAGCAACGGAAATCGA
CAACAACCCCCCGGCAGACAGCGTCAACCCCCCGGACCGATCAGCACCCCGGTCTTCCATGGGCGGAAGCCTGCT
CTCGCCTCTCCGAACAGGACATAGGATGTCGCTCCGGATCAGTCCCGCGCGGGCCCTTTTCCCGGACAGAGGAGT
CAGACCTCTCACAAGCCTCGACGATCCAGGCAGCAACATCAACATCCACAACAGCAGCATCGACGGCGACGACGA
CAACGACGACGGCAGTCCCCTTTTCGTCTTCGGAGCAGCCGAGCGAAGAAAAGGCATATCAATCCTACGACAAGC
AGCTTGCCAACAACGCCCAACGACAGCAGCAGAAGAAGGAGAAGGACAACAAGACAGGTCGCAGCCAAAACATGC
CTCCCTCCTCTCCATCCTTGGAACCATCTGGCCAAGACTCAAGGCAAAGGAGAGACTAACGCTCATCCTCGGCCT
CATCATCTGCTCCGTCGCCGCCACAGCAACACCAGCTTTTGCATTCTGTCTCTCCCGACTCATGTCGGTAATGTG
GTCTTCAGGCGACAAGCTCGTCCAAGGTCGTCAATGGGCTCTCCTCCTTACCGGCGTCGCCATAACCGACGGCCT
CTGCACAGGTCTAGGTCGCTATTTGCTCGAACTGGTGGCTCAGTCCTGGACAGATGGTATCCGGACCCAAGCCAT
GGCCAGCATCTTGAAACAGAAGAGACCGTGGTTCGATGGCGTCAAGCACGCGCCCAGTCGCCTGGCGGAATGTCT
GGAGCGCAACGCCGAGGAGATGCGCAACGTCGTCGGTCGTTTCCTTGCCATTCTCGTCTTCGTTTCCGTCATCAT
GACGCTTTCCATCCTTTGGGCCCTCGTCGTCGACTGGAGACTTTCGCTCGTTGCTCTTGCGCCTTTGCCCTTGAC
CTTGGCTGCCGTCAGGGGTTATGCCACCGTTAGTGGCGAATGGGAAAGGCGTTGTAATGACGCGGCCGAGGAATC
TAGCGCCATGGCGACCGAGACGCTCATCGGCATTCGTCTCGTTCGTGCTCTCGACCTTTCCGCTCGTCAGACGAC
TCGTTACCAAACCAGCGCCATCCGAACCCGTTCTCTCGGTATGGCCCGTGCCAGGAGAACAAGTTGCATCTTCGG
CCTCTATCAATCCATGGGCTACGCCTTATCCGCTCTCGTCTTTTATTACGGCACTCGTCGACTGACGTCGGCAAC
CGTCGACGTCGCAGCCGTCTTACACGTCATCACTCTTCTGCTCTTCGCCATAGGAACTTCCAGCGAGATGCTGGA
TGGTTTACCTCAGTTGACCTTGGCCCAGGCTGCTGCCGGACCTTTACTCGACTACGCCGCACTGCCAAAACCGAG
ACGACGACTGCAACAGCTAGTCTCACTCCCTCTCCGTTTCCACAACCTCGTCTTCTCTTATCCCGCTAGTCGGGA
GCCCATCCTTGGCGGCCTGTCGCTCGAGATCCGTCCAGGGGAGAGCATCGCCATAGTCGGCCCTTCAGGCTGCGG
CAAATCAACTCTTCTCTCCCTCATCCTAGGCCTCTACCCACCCACCAGACCAGCCCTGGGCACCGCCCTCGTCCC
CCAATCGCCCACCGTCTTCCCGGCCACCATTTCCGAAAACATCCTCTATGGCCTCCCTTCCAACTCGCCCCTACG
CAAAGCCGGCTCGTTAGAAGCCGCCTCTCAAGCAGCAGGCGTACACGCCTTCGCCTCGTCGCTACCGCAAGGCTA
CGCCACGCCCGTCGGCGACGGTGGCCAGACATTATCCGGTGGCCAGGCTCAGAGACTCGCCATCGCTCGAGCTCT
CGTTCGTTGTCCGCAGCTGCTCGTCATGGATGAGCCGACGAGCGCGCTTGACGCCGAGTCTGCCAAGAGGGTGCG
TCACGCCATGAGGGTCGTGGCCGGTTTGGGCGCCGCTGTCGTCGTCGCAACCCATTGTCCCTACATGATGCGAGC
CGCTGATCGGGTCGTTGTTCTCGGTCGTGGCGTCGTCGTCGAGCAAGGTCGCTTCCAGGATCTGGTTAGGAAAGG
GGGGGCTCTCTCGCATCTTGTCTCCGGCGGACAGTGGAATGGGGAGAGGGCCGCGGGGGATTGTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail