Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4074
Gene name
Locationscaffold_32:2011..3362
Strand-
Gene length (bp)1351
Transcript length (bp)1221
Coding sequence length (bp)1218
Protein length (aa) 406

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06516 NUP Purine nucleoside permease (NUP) 2.4E-130 31 352

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O93844|NUP_CANAX Purine nucleoside permease OS=Candida albicans GN=NUP PE=3 SV=1 28 375 1.0E-94
sp|Q5AGW8|NUP_CANAL Purine nucleoside permease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUP PE=1 SV=1 28 375 1.0E-94
sp|O74493|NUP_SCHPO Probable purine nucleoside permease C285.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC285.05 PE=3 SV=1 28 344 4.0E-74

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1885 0.0859 0.7187 0.124 0.0908 0.0265 0.243 0.4046 0.1958 0.0031

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.82758

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4557
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5695
Ophiocordyceps australis map64 (Brazil) OphauB2|5491
Ophiocordyceps camponoti-floridani Ophcf2|00063
Ophiocordyceps camponoti-rufipedis Ophun1|625
Ophiocordyceps kimflemingae Ophio5|4074 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9538

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4074
MMPYSRLFLAFVLLGIRAAADSAACAGVISPRVMIISMFAPEADSWHSRFHESKLGNLSAVAIASSGLSILFPHV
SCTQDGLICQATLGEGEINAAASMTALMLSPNFHLARTYFLLAGIAGVSPRQATLGSVALARFAVQAALQTEIDP
RSLPANWSTGYIPFGRSVPFEYPAILYGTEVFELNTGLRDAAFTLASRATLADDDASRRYRALYGRHGPYAKATL
PPAVVKCDCTTSDVYYSGTILSEVFENTTHVWTNGTGVYCMTAQEDNAALEVLVRAAVEGIVDYSRVMVMRTASD
FDRPPPGVSDLHHLTRVDQNGFKIATENLYRAGIEIVKGILADWQPTYSGGVPAPNYLGDIFGTLGGNPDFGPGS
RTHGRPVSPAVSRGHRPRARRAMRHVEVPAS
Coding >Ophio5|4074
ATGATGCCCTATTCGCGACTGTTCCTCGCCTTTGTGCTGCTCGGGATCCGTGCTGCGGCCGACAGCGCGGCATGT
GCTGGCGTGATTTCGCCCCGGGTCATGATTATCTCCATGTTCGCTCCAGAGGCAGACTCCTGGCACTCGCGCTTC
CACGAGTCCAAGCTCGGCAATCTCTCCGCCGTGGCCATCGCTTCGTCTGGCCTCTCGATACTCTTCCCGCACGTC
TCGTGCACTCAGGACGGCCTCATCTGCCAGGCCACGCTTGGTGAAGGAGAGATCAACGCAGCGGCCTCCATGACG
GCTCTCATGCTCTCGCCCAACTTCCACCTCGCGCGCACCTACTTTCTCCTCGCCGGCATCGCAGGCGTCAGCCCC
CGTCAAGCCACGCTCGGCAGCGTCGCCCTCGCCCGCTTCGCCGTCCAGGCCGCGCTCCAGACTGAGATAGACCCG
CGCTCGCTCCCGGCCAATTGGTCAACGGGCTACATCCCCTTCGGCCGCAGCGTTCCGTTCGAGTACCCAGCCATC
CTCTACGGCACCGAAGTCTTTGAGCTCAACACCGGCCTCCGAGATGCCGCCTTCACGCTCGCCTCCCGCGCCACC
CTGGCAGACGACGATGCTTCGCGCCGATACCGCGCCCTCTATGGCCGCCACGGGCCCTACGCAAAGGCTACGCTG
CCTCCGGCCGTGGTCAAGTGCGACTGTACTACCAGCGACGTCTACTACTCCGGCACCATCTTGTCCGAGGTCTTT
GAGAACACGACACACGTGTGGACAAACGGCACCGGCGTCTACTGCATGACGGCCCAGGAGGACAACGCGGCGCTC
GAGGTGCTGGTCCGTGCCGCCGTCGAAGGCATCGTCGACTATTCCCGAGTCATGGTGATGCGGACCGCGTCCGAC
TTTGACCGGCCCCCGCCCGGCGTCTCCGACCTCCACCACCTCACGCGCGTCGACCAAAACGGGTTCAAGATCGCA
ACGGAAAACCTTTACCGAGCCGGCATCGAAATTGTGAAGGGCATCCTCGCAGACTGGCAGCCCACGTATAGTGGC
GGGGTCCCGGCCCCGAATTACCTAGGCGACATCTTTGGCACCCTCGGCGGGAATCCGGATTTTGGCCCTGGAAGT
AGGACTCATGGCAGGCCCGTGTCTCCCGCCGTTAGTCGCGGTCATCGGCCGAGGGCTCGGAGGGCTATGCGTCAT
GTCGAGGTGCCCGCTTCG
Transcript >Ophio5|4074
ATGATGCCCTATTCGCGACTGTTCCTCGCCTTTGTGCTGCTCGGGATCCGTGCTGCGGCCGACAGCGCGGCATGT
GCTGGCGTGATTTCGCCCCGGGTCATGATTATCTCCATGTTCGCTCCAGAGGCAGACTCCTGGCACTCGCGCTTC
CACGAGTCCAAGCTCGGCAATCTCTCCGCCGTGGCCATCGCTTCGTCTGGCCTCTCGATACTCTTCCCGCACGTC
TCGTGCACTCAGGACGGCCTCATCTGCCAGGCCACGCTTGGTGAAGGAGAGATCAACGCAGCGGCCTCCATGACG
GCTCTCATGCTCTCGCCCAACTTCCACCTCGCGCGCACCTACTTTCTCCTCGCCGGCATCGCAGGCGTCAGCCCC
CGTCAAGCCACGCTCGGCAGCGTCGCCCTCGCCCGCTTCGCCGTCCAGGCCGCGCTCCAGACTGAGATAGACCCG
CGCTCGCTCCCGGCCAATTGGTCAACGGGCTACATCCCCTTCGGCCGCAGCGTTCCGTTCGAGTACCCAGCCATC
CTCTACGGCACCGAAGTCTTTGAGCTCAACACCGGCCTCCGAGATGCCGCCTTCACGCTCGCCTCCCGCGCCACC
CTGGCAGACGACGATGCTTCGCGCCGATACCGCGCCCTCTATGGCCGCCACGGGCCCTACGCAAAGGCTACGCTG
CCTCCGGCCGTGGTCAAGTGCGACTGTACTACCAGCGACGTCTACTACTCCGGCACCATCTTGTCCGAGGTCTTT
GAGAACACGACACACGTGTGGACAAACGGCACCGGCGTCTACTGCATGACGGCCCAGGAGGACAACGCGGCGCTC
GAGGTGCTGGTCCGTGCCGCCGTCGAAGGCATCGTCGACTATTCCCGAGTCATGGTGATGCGGACCGCGTCCGAC
TTTGACCGGCCCCCGCCCGGCGTCTCCGACCTCCACCACCTCACGCGCGTCGACCAAAACGGGTTCAAGATCGCA
ACGGAAAACCTTTACCGAGCCGGCATCGAAATTGTGAAGGGCATCCTCGCAGACTGGCAGCCCACGTATAGTGGC
GGGGTCCCGGCCCCGAATTACCTAGGCGACATCTTTGGCACCCTCGGCGGGAATCCGGATTTTGGCCCTGGAAGT
AGGACTCATGGCAGGCCCGTGTCTCCCGCCGTTAGTCGCGGTCATCGGCCGAGGGCTCGGAGGGCTATGCGTCAT
GTCGAGGTGCCCGCTTCGTGA
Gene >Ophio5|4074
ATGATGCCCTATTCGCGACTGTTCCTCGCCTTTGTGCTGCTCGGGATCCGTGCTGCGGCCGACAGCGCGGCATGT
GCTGGCGTGATTTCGCCCCGGGTCATGATTATCTCCATGGCAAGGCCGCCCCTTCTCCTGCTACAGGGAAAGCAT
CCGCTCTAACGACTTCGTGACCGATCCAGTTCGCTCCAGAGGCAGACTCCTGGCACTCGCGCTTCCACGAGTCCA
AGCTCGGCAATCTCTCCGCCGTGGCCATCGCTTCGTCTGGCCTCTCGATACTCTTCCCGCACGTCTCGTGCACTC
AGGACGGCCTCATCTGCCAGGCCACGCTTGGTGAAGGAGAGATCAACGCAGCGGCCTCCATGACGGCTCTCATGC
TCTCGCCCAACTTCCACCTCGCGCGCACCTACTTTCTCCTCGCCGGCATCGCAGGCGTCAGCCCCCGTCAAGCCA
CGCTCGGCAGCGTCGCCCTCGCCCGCTTCGCCGTCCAGGCCGCGCTCCAGACTGAGATAGACCCGCGCTCGCTCC
CGGCCAATTGGTCAACGGGCTACATCCCCTTCGGCCGCAGCGTTCCGTTCGAGTACCCAGCCATCCTCTACGGCA
CCGAAGTCTTTGAGCTCAACACCGGCCTCCGAGATGCCGCCTTCACGCTCGCCTCCCGCGCCACCCTGGCAGACG
ACGATGCTTCGCGCCGATACCGCGCCCTCTATGGCCGCCACGGGCCCTACGCAAAGGCTACGCTGCCTCCGGCCG
TGGTCAAGTGCGACTGTACTACCAGCGACGTCTACTACTCCGGCACCATCTTGTCCGAGGTCTTTGAGAACACGA
CACACGTGTGGACAAACGGCACCGGCGTCTACTGCATGACGGCCCAGGAGGACAACGCGGCGCTCGAGGTGCTGG
TCCGTGCCGCCGTCGAAGGCATCGTCGACTATTCCCGAGTCATGGTGATGCGGACCGGTGAGTTTGGGGGCATAT
GAGACCAAAAAGAAAAAGGAAGCACTTCCCCCATTAACGAAAAGCAGCGTCCGACTTTGACCGGCCCCCGCCCGG
CGTCTCCGACCTCCACCACCTCACGCGCGTCGACCAAAACGGGTTCAAGATCGCAACGGAAAACCTTTACCGAGC
CGGCATCGAAATTGTGAAGGGCATCCTCGCAGACTGGCAGCCCACGTATAGTGGCGGGGTCCCGGCCCCGAATTA
CCTAGGCGACATCTTTGGCACCCTCGGCGGGAATCCGGATTTTGGCCCTGGAAGTAGGACTCATGGCAGGCCCGT
GTCTCCCGCCGTTAGTCGCGGTCATCGGCCGAGGGCTCGGAGGGCTATGCGTCATGTCGAGGTGCCCGCTTCGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail