Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4067
Gene name
Locationscaffold_318:20752..22411
Strand-
Gene length (bp)1659
Transcript length (bp)1593
Coding sequence length (bp)1590
Protein length (aa) 530

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 4.8E-50 9 365
PF11954 DUF3471 Domain of unknown function (DUF3471) 3.9E-12 425 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 16 338 5.0E-16
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 17 375 2.0E-11
sp|P0AD70|AMPH_ECOLI D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli (strain K12) GN=ampH PE=1 SV=1 4 367 2.0E-11
sp|P0AD71|AMPH_ECO57 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli O157:H7 GN=ampH PE=3 SV=1 4 367 2.0E-11
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 4 258 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 16 338 5.0E-16
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 17 375 2.0E-11
sp|P0AD70|AMPH_ECOLI D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli (strain K12) GN=ampH PE=1 SV=1 4 367 2.0E-11
sp|P0AD71|AMPH_ECO57 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli O157:H7 GN=ampH PE=3 SV=1 4 367 2.0E-11
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 4 258 2.0E-11
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 17 375 7.0E-11
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 57 259 4.0E-10
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 13 357 1.0E-09
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 8 355 8.0E-09
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 13 374 9.0E-09
sp|P94958|AMPC_MORMO Beta-lactamase OS=Morganella morganii GN=ampC PE=3 SV=1 13 357 2.0E-08
sp|Q5FRJ7|DAP_GLUOX D-aminopeptidase OS=Gluconobacter oxydans (strain 621H) GN=dap PE=3 SV=1 6 364 5.0E-08
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 12 368 3.0E-07
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 11 372 5.0E-07
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 16 259 6.0E-07
sp|P05364|AMPC_ENTCL Beta-lactamase OS=Enterobacter cloacae GN=ampC PE=1 SV=1 13 357 9.0E-07
sp|B5RCU8|YFEW_SALG2 UPF0214 protein YfeW OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yfeW PE=3 SV=1 41 200 1.0E-06
sp|P77619|YFEW_ECOLI UPF0214 protein YfeW OS=Escherichia coli (strain K12) GN=yfeW PE=3 SV=2 41 200 6.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8608 0.3371 0.0675 0.1142 0.1001 0.0294 0.1566 0.0647 0.175 0.0155

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115
Ophiocordyceps camponoti-floridani Ophcf2|03858
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044
Ophiocordyceps camponoti-rufipedis Ophun1|7452
Ophiocordyceps kimflemingae Ophio5|1649
Ophiocordyceps kimflemingae Ophio5|4067 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1745
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4067
MDIVRSPDFAAYVTRLMERFHVPGVAVAVAQGEEVVSTGFGKASLDPEVDCTADTLFNMASASKSLTAASVALLI
ADDGHPDVQWEAPMEKLLPGDFVMPGNDHTDVTVEDILSHRTGMPSHDNSYLGCSAANPDDPRSITRNLRNLAVV
APNRSGYIYCNMMYTVASYLVERVSGLPFTDYLEARLLQPLGMMDTCLQPARARAKGLGDRIAKGYVWDESAGKY
DETPCDDDAPEAQGAGCILSSANDYIKWVQAMMNRSGPISDDVYQGLVKQRIRQGDDDVPDDVVEDAEAESGASS
RSETPPPPPLYYAAGWEVRKYCKHTIVSHDGSEEGFRTNHFFVPELKFGGVVVGNSDGAADVVSELTHRLIDEVV
QGPDAGRGLLDSSSDSGSDSGSGSVTDEDDEPKSAGPVAELREQLCPGIKEVQPQTMPLSAYTGRYWNEGYREMV
VDDHDGQLVVDATKRSMGFHLRLEHVSDQTKYLAYLRERFDKDGSPLKAEFRLQGDRAVKLGLWLEERMKDYVWF
ERIHD
Coding >Ophio5|4067
ATGGATATCGTCCGCTCGCCAGATTTTGCCGCCTACGTGACGCGGCTCATGGAGCGCTTCCACGTGCCGGGTGTG
GCCGTGGCCGTGGCCCAGGGCGAAGAGGTCGTGTCTACTGGCTTCGGAAAGGCATCGCTCGACCCAGAGGTGGAC
TGCACGGCCGACACGCTCTTCAACATGGCATCGGCTTCCAAGTCGCTGACGGCGGCGTCGGTGGCGCTTCTCATT
GCCGACGACGGCCATCCGGACGTGCAGTGGGAAGCGCCCATGGAGAAGCTTCTACCGGGCGACTTCGTAATGCCC
GGAAACGACCACACTGATGTTACTGTCGAAGACATCCTCAGCCACCGGACCGGCATGCCGTCACACGACAACTCA
TACCTCGGCTGCTCCGCGGCAAACCCCGACGACCCGCGGTCCATCACGCGCAACCTGCGCAACCTGGCGGTCGTG
GCGCCGAATCGTAGCGGCTACATCTACTGCAATATGATGTATACCGTCGCCAGCTATTTGGTGGAGCGCGTTAGC
GGGCTTCCCTTTACCGACTACCTCGAAGCACGCCTCCTGCAGCCCTTGGGGATGATGGATACCTGTTTGCAACCG
GCACGCGCTCGCGCCAAGGGATTGGGCGACCGCATCGCCAAGGGTTACGTGTGGGACGAGTCTGCGGGCAAGTAT
GACGAGACACCGTGTGACGACGACGCACCTGAGGCGCAGGGCGCTGGATGTATCCTCTCGAGTGCCAACGACTAC
ATCAAGTGGGTGCAGGCCATGATGAACCGTTCGGGACCAATCTCCGACGACGTCTACCAGGGGCTCGTCAAGCAG
CGGATCCGGCAGGGAGACGACGACGTTCCGGACGACGTCGTCGAAGACGCCGAGGCTGAGAGCGGCGCGTCATCG
AGGTCCGAGACGCCCCCGCCCCCGCCCCTCTACTATGCGGCCGGCTGGGAGGTGCGCAAGTACTGCAAGCACACC
ATAGTGTCGCACGACGGGTCCGAGGAGGGCTTCCGCACCAACCACTTCTTCGTGCCGGAGCTCAAGTTTGGCGGC
GTCGTCGTCGGCAACTCGGACGGGGCCGCCGACGTGGTCAGTGAGTTGACGCATCGGCTGATCGACGAGGTCGTG
CAGGGACCGGACGCCGGCAGAGGTTTGCTTGACTCGTCTTCCGACTCGGGATCTGACTCTGGCTCGGGGTCGGTC
ACGGACGAAGACGATGAGCCCAAGTCTGCTGGTCCGGTGGCGGAGCTGCGAGAGCAGCTCTGCCCCGGCATCAAG
GAGGTGCAACCACAGACGATGCCGCTATCGGCGTACACGGGAAGGTACTGGAACGAAGGCTATCGCGAAATGGTC
GTAGACGACCATGACGGCCAGCTGGTCGTGGACGCGACCAAGCGATCCATGGGCTTTCATCTGAGGCTCGAGCAC
GTCAGCGACCAGACCAAGTACCTGGCCTATCTCAGGGAGCGGTTTGACAAGGATGGTTCGCCACTCAAGGCCGAG
TTCCGGCTCCAAGGCGACAGGGCGGTCAAATTGGGACTGTGGCTGGAGGAGCGGATGAAGGATTACGTATGGTTC
GAGCGGATCCATGAC
Transcript >Ophio5|4067
ATGGATATCGTCCGCTCGCCAGATTTTGCCGCCTACGTGACGCGGCTCATGGAGCGCTTCCACGTGCCGGGTGTG
GCCGTGGCCGTGGCCCAGGGCGAAGAGGTCGTGTCTACTGGCTTCGGAAAGGCATCGCTCGACCCAGAGGTGGAC
TGCACGGCCGACACGCTCTTCAACATGGCATCGGCTTCCAAGTCGCTGACGGCGGCGTCGGTGGCGCTTCTCATT
GCCGACGACGGCCATCCGGACGTGCAGTGGGAAGCGCCCATGGAGAAGCTTCTACCGGGCGACTTCGTAATGCCC
GGAAACGACCACACTGATGTTACTGTCGAAGACATCCTCAGCCACCGGACCGGCATGCCGTCACACGACAACTCA
TACCTCGGCTGCTCCGCGGCAAACCCCGACGACCCGCGGTCCATCACGCGCAACCTGCGCAACCTGGCGGTCGTG
GCGCCGAATCGTAGCGGCTACATCTACTGCAATATGATGTATACCGTCGCCAGCTATTTGGTGGAGCGCGTTAGC
GGGCTTCCCTTTACCGACTACCTCGAAGCACGCCTCCTGCAGCCCTTGGGGATGATGGATACCTGTTTGCAACCG
GCACGCGCTCGCGCCAAGGGATTGGGCGACCGCATCGCCAAGGGTTACGTGTGGGACGAGTCTGCGGGCAAGTAT
GACGAGACACCGTGTGACGACGACGCACCTGAGGCGCAGGGCGCTGGATGTATCCTCTCGAGTGCCAACGACTAC
ATCAAGTGGGTGCAGGCCATGATGAACCGTTCGGGACCAATCTCCGACGACGTCTACCAGGGGCTCGTCAAGCAG
CGGATCCGGCAGGGAGACGACGACGTTCCGGACGACGTCGTCGAAGACGCCGAGGCTGAGAGCGGCGCGTCATCG
AGGTCCGAGACGCCCCCGCCCCCGCCCCTCTACTATGCGGCCGGCTGGGAGGTGCGCAAGTACTGCAAGCACACC
ATAGTGTCGCACGACGGGTCCGAGGAGGGCTTCCGCACCAACCACTTCTTCGTGCCGGAGCTCAAGTTTGGCGGC
GTCGTCGTCGGCAACTCGGACGGGGCCGCCGACGTGGTCAGTGAGTTGACGCATCGGCTGATCGACGAGGTCGTG
CAGGGACCGGACGCCGGCAGAGGTTTGCTTGACTCGTCTTCCGACTCGGGATCTGACTCTGGCTCGGGGTCGGTC
ACGGACGAAGACGATGAGCCCAAGTCTGCTGGTCCGGTGGCGGAGCTGCGAGAGCAGCTCTGCCCCGGCATCAAG
GAGGTGCAACCACAGACGATGCCGCTATCGGCGTACACGGGAAGGTACTGGAACGAAGGCTATCGCGAAATGGTC
GTAGACGACCATGACGGCCAGCTGGTCGTGGACGCGACCAAGCGATCCATGGGCTTTCATCTGAGGCTCGAGCAC
GTCAGCGACCAGACCAAGTACCTGGCCTATCTCAGGGAGCGGTTTGACAAGGATGGTTCGCCACTCAAGGCCGAG
TTCCGGCTCCAAGGCGACAGGGCGGTCAAATTGGGACTGTGGCTGGAGGAGCGGATGAAGGATTACGTATGGTTC
GAGCGGATCCATGACTGA
Gene >Ophio5|4067
ATGGATATCGTCCGCTCGCCAGATTTTGCCGCCTACGTGACGCGGCTCATGGAGCGCTTCCACGTGCCGGGTGTG
GCCGTGGCCGTGGCCCAGGGCGAAGAGGTCGTGTCTACTGGCTTCGGAAAGGCATCGCTCGACCCAGAGGTGGAC
TGCACGGCCGACACGCTCTTCAACATGGCATCGGCTTCCAAGTCGCTGACGGCGGCGTCGGTGGCGCTTCTCATT
GCCGACGACGGCCATCCGGACGTGCAGTGGGAAGCGCCCATGGAGAAGCTTCTACCGGGCGACTTCGTAATGCCC
GGAAACGACCACACTGATGTTACTGTCGAAGACATCCTCAGCCACCGGACCGGCATGCCGTCGTGAGTTCTGTTC
TCCACCTCCCTTCCATGACTGTATAAGAGTCTAGCTAACCGCCGCGGACAAAGACACGACAACTCATACCTCGGC
TGCTCCGCGGCAAACCCCGACGACCCGCGGTCCATCACGCGCAACCTGCGCAACCTGGCGGTCGTGGCGCCGAAT
CGTAGCGGCTACATCTACTGCAATATGATGTATACCGTCGCCAGCTATTTGGTGGAGCGCGTTAGCGGGCTTCCC
TTTACCGACTACCTCGAAGCACGCCTCCTGCAGCCCTTGGGGATGATGGATACCTGTTTGCAACCGGCACGCGCT
CGCGCCAAGGGATTGGGCGACCGCATCGCCAAGGGTTACGTGTGGGACGAGTCTGCGGGCAAGTATGACGAGACA
CCGTGTGACGACGACGCACCTGAGGCGCAGGGCGCTGGATGTATCCTCTCGAGTGCCAACGACTACATCAAGTGG
GTGCAGGCCATGATGAACCGTTCGGGACCAATCTCCGACGACGTCTACCAGGGGCTCGTCAAGCAGCGGATCCGG
CAGGGAGACGACGACGTTCCGGACGACGTCGTCGAAGACGCCGAGGCTGAGAGCGGCGCGTCATCGAGGTCCGAG
ACGCCCCCGCCCCCGCCCCTCTACTATGCGGCCGGCTGGGAGGTGCGCAAGTACTGCAAGCACACCATAGTGTCG
CACGACGGGTCCGAGGAGGGCTTCCGCACCAACCACTTCTTCGTGCCGGAGCTCAAGTTTGGCGGCGTCGTCGTC
GGCAACTCGGACGGGGCCGCCGACGTGGTCAGTGAGTTGACGCATCGGCTGATCGACGAGGTCGTGCAGGGACCG
GACGCCGGCAGAGGTTTGCTTGACTCGTCTTCCGACTCGGGATCTGACTCTGGCTCGGGGTCGGTCACGGACGAA
GACGATGAGCCCAAGTCTGCTGGTCCGGTGGCGGAGCTGCGAGAGCAGCTCTGCCCCGGCATCAAGGAGGTGCAA
CCACAGACGATGCCGCTATCGGCGTACACGGGAAGGTACTGGAACGAAGGCTATCGCGAAATGGTCGTAGACGAC
CATGACGGCCAGCTGGTCGTGGACGCGACCAAGCGATCCATGGGCTTTCATCTGAGGCTCGAGCACGTCAGCGAC
CAGACCAAGTACCTGGCCTATCTCAGGGAGCGGTTTGACAAGGATGGTTCGCCACTCAAGGCCGAGTTCCGGCTC
CAAGGCGACAGGGCGGTCAAATTGGGACTGTGGCTGGAGGAGCGGATGAAGGATTACGTATGGTTCGAGCGGATC
CATGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail