Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4066
Gene name
Locationscaffold_318:8932..19170
Strand-
Gene length (bp)10238
Transcript length (bp)10176
Coding sequence length (bp)10173
Protein length (aa) 3391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.7E-18 37 282
PF00501 AMP-binding AMP-binding enzyme 1.8E-68 1009 1404
PF00501 AMP-binding AMP-binding enzyme 2.0E-69 2785 3189
PF00668 Condensation Condensation domain 1.4E-32 555 974
PF00668 Condensation Condensation domain 2.8E-18 1629 1775
PF00668 Condensation Condensation domain 7.3E-16 1833 2054
PF00668 Condensation Condensation domain 4.0E-29 2096 2482
PF00550 PP-binding Phosphopantetheine attachment site 3.4E-06 445 508
PF00550 PP-binding Phosphopantetheine attachment site 3.3E-09 1539 1601
PF00550 PP-binding Phosphopantetheine attachment site 2.0E-11 3326 3387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 444 2551 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 404 2505 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 740 2450 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 404 2419 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 417 2509 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 444 2551 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 404 2505 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 740 2450 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 404 2419 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 417 2509 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1003 2508 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 440 1684 4.0E-175
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 440 1684 6.0E-175
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 444 1684 2.0E-169
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 443 2416 6.0E-142
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2691 3388 8.0E-139
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2521 3390 3.0E-138
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 443 2451 2.0E-132
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 444 2384 4.0E-131
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 482 1684 9.0E-130
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 442 2479 1.0E-128
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 408 1603 6.0E-128
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 442 2416 6.0E-128
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1530 2473 7.0E-128
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 433 1773 1.0E-127
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2523 3388 2.0E-125
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 521 2416 5.0E-125
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2539 3386 2.0E-123
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2517 3386 1.0E-122
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 985 1773 4.0E-122
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2517 3386 1.0E-121
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 420 1631 2.0E-121
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 442 2416 3.0E-121
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 554 1602 1.0E-120
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 926 2458 3.0E-116
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 550 1934 7.0E-116
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 929 2523 3.0E-115
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2534 3385 4.0E-115
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 515 1772 4.0E-114
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 423 2416 7.0E-114
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 547 1760 3.0E-111
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2344 3386 1.0E-110
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 444 2059 9.0E-110
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2778 3379 7.0E-107
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2589 3388 9.0E-107
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2778 3379 1.0E-106
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2778 3379 2.0E-106
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 945 1599 2.0E-105
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 440 2082 3.0E-105
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 556 1831 7.0E-105
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 934 1684 1.0E-104
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1000 2082 2.0E-104
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2720 3386 8.0E-104
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 530 1697 1.0E-103
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 989 2082 3.0E-103
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1000 2082 4.0E-103
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2712 3386 8.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2778 3388 2.0E-101
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 551 1815 7.0E-101
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2535 3389 8.0E-100
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 999 1690 4.0E-99
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 444 1975 7.0E-99
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 430 2054 2.0E-98
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 443 2086 1.0E-97
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 547 1780 4.0E-97
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 547 1780 7.0E-97
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2708 3391 8.0E-97
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2733 3386 2.0E-96
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 444 2074 2.0E-96
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2768 3388 1.0E-95
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 436 1612 1.0E-95
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 551 1760 2.0E-95
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1001 2081 2.0E-95
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 550 1791 3.0E-95
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2716 3388 7.0E-95
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2607 3388 1.0E-94
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 951 2053 2.0E-94
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2767 3387 2.0E-93
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1002 1603 2.0E-92
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 990 2058 1.0E-90
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1000 1594 6.0E-89
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2761 3385 1.0E-87
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1000 1594 1.0E-87
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1000 1684 1.0E-87
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 443 2081 1.0E-87
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 546 1847 3.0E-87
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2730 3387 1.0E-86
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 551 1525 3.0E-86
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 557 1782 3.0E-86
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 550 1770 4.0E-85
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 547 1786 1.0E-84
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2674 3378 2.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 538 1786 2.0E-83
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 551 2095 8.0E-83
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 442 2082 3.0E-82
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 603 1603 5.0E-82
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 999 1771 1.0E-81
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2778 3386 1.0E-80
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 516 1776 1.0E-80
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 549 1771 4.0E-80
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 496 1612 5.0E-80
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2623 3386 6.0E-80
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 547 1798 2.0E-79
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 442 1977 2.0E-79
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2587 3386 4.0E-79
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 953 1772 6.0E-79
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 442 2049 4.0E-78
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 547 1798 4.0E-78
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 442 1774 9.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2587 3391 2.0E-75
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 549 1599 4.0E-75
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2587 3380 2.0E-74
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 440 1791 4.0E-74
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 549 1773 5.0E-74
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1024 1977 8.0E-73
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 442 1801 1.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 442 1791 2.0E-72
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 441 1023 5.0E-72
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 550 1599 7.0E-72
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 473 1611 1.0E-71
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 442 1773 2.0E-70
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 377 1573 2.0E-70
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 440 1791 3.0E-70
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 543 1629 2.0E-69
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 442 1777 1.0E-68
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2755 3386 2.0E-68
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 441 1695 2.0E-68
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 442 1776 2.0E-68
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 440 1791 3.0E-68
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 429 1656 1.0E-67
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 441 1982 1.0E-67
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2593 3388 3.0E-67
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 441 1982 3.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2589 3391 4.0E-67
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 539 1788 7.0E-67
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2587 3386 8.0E-67
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 644 1797 1.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2589 3386 2.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 443 1777 3.0E-66
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2593 3386 4.0E-66
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 441 1797 4.0E-66
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 441 1797 5.0E-66
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 442 1771 1.0E-65
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2539 3387 1.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2516 3386 1.0E-65
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2516 3386 2.0E-65
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 556 1783 3.0E-65
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1027 1599 1.0E-64
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 987 1795 2.0E-64
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2693 3387 2.0E-64
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2707 3386 5.0E-64
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 999 2065 5.0E-64
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2590 3386 6.0E-64
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2716 3386 8.0E-64
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2587 3382 9.0E-64
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2707 3386 1.0E-63
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2587 3385 2.0E-63
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2715 3387 2.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2593 3386 9.0E-63
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2539 3370 1.0E-62
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2707 3388 2.0E-62
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2558 3386 2.0E-62
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2778 3388 2.0E-62
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 552 1684 2.0E-62
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 984 1601 3.0E-62
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2786 3386 5.0E-62
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1002 1786 6.0E-62
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 428 1578 8.0E-62
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2715 3386 8.0E-62
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 438 1791 8.0E-62
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2710 3386 1.0E-61
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 380 1684 1.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2587 3386 2.0E-61
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 442 1801 2.0E-61
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 427 1801 2.0E-61
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 404 1684 3.0E-61
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 438 1791 4.0E-61
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2519 3303 9.0E-61
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2779 3385 2.0E-60
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2598 3387 2.0E-60
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2789 3390 2.0E-60
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2710 3386 4.0E-60
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2785 3387 6.0E-60
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2779 3385 8.0E-60
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2622 3388 9.0E-60
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 434 1599 9.0E-60
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 647 1760 1.0E-59
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2708 3386 2.0E-59
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2785 3388 2.0E-59
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2581 3386 2.0E-59
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2692 3386 3.0E-59
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 999 1786 4.0E-59
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1442 2436 4.0E-59
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2699 3385 8.0E-59
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2605 3386 8.0E-59
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2710 3386 1.0E-58
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1644 2050 3.0E-58
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2785 3387 3.0E-58
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2587 3386 5.0E-58
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1001 1792 6.0E-58
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 444 1599 6.0E-58
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1024 1975 9.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2587 3386 1.0E-57
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2581 3386 2.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2593 3388 2.0E-57
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2609 3373 2.0E-57
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2580 3387 2.0E-57
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2785 3386 3.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2609 3373 3.0E-57
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2586 3386 4.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 444 1599 4.0E-57
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2778 3391 6.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2596 3388 2.0E-56
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2589 3386 2.0E-56
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2715 3385 2.0E-56
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2764 3388 5.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2785 3386 5.0E-56
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2787 3391 7.0E-56
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 440 1719 8.0E-56
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 556 1599 1.0E-55
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2587 3386 2.0E-55
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2770 3386 2.0E-55
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1957 2506 1.0E-54
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 909 1779 1.0E-54
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 771 1604 2.0E-54
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2542 3386 3.0E-54
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2542 3386 3.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2768 3388 5.0E-54
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2639 3386 6.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2587 3386 9.0E-54
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2748 3391 9.0E-54
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2778 3386 1.0E-53
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2748 3391 2.0E-53
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2697 3386 2.0E-53
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2593 3388 3.0E-53
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2785 3388 4.0E-53
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2785 3387 6.0E-53
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2587 3388 9.0E-53
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1003 1777 2.0E-52
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1003 1777 2.0E-52
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2777 3387 3.0E-52
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2677 3386 5.0E-52
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2677 3386 5.0E-52
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 938 1599 6.0E-52
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2706 3386 7.0E-52
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2589 3386 1.0E-51
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2587 3386 3.0E-51
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2587 3387 3.0E-51
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2605 3388 4.0E-51
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2697 3360 4.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2779 3390 1.0E-50
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 921 1599 2.0E-50
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2791 3361 3.0E-50
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2778 3378 3.0E-50
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2778 3388 4.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2774 3388 3.0E-48
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1003 1771 6.0E-48
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2096 2507 2.0E-47
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2777 3387 3.0E-47
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2710 3236 6.0E-47
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2780 3385 3.0E-46
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 922 1768 4.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2779 3386 1.0E-45
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1022 1770 3.0E-45
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2551 3387 6.0E-45
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1028 1598 2.0E-44
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2781 3391 3.0E-44
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2786 3388 5.0E-44
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2750 3388 6.0E-44
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2802 3388 7.0E-44
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2779 3386 8.0E-44
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2767 3388 1.0E-43
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2699 3377 2.0E-43
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 933 1429 3.0E-43
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2770 3360 6.0E-43
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2770 3360 9.0E-43
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2589 3360 1.0E-42
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2582 3391 1.0E-42
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2770 3360 1.0E-42
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1027 1619 2.0E-42
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2779 3388 1.0E-41
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2779 3388 1.0E-41
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 976 1622 2.0E-41
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 976 1622 2.0E-41
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 976 1622 2.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 954 1601 4.0E-41
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2729 3388 9.0E-41
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2729 3388 1.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2729 3388 1.0E-40
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2800 3387 1.0E-40
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 954 1601 2.0E-40
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 426 1475 3.0E-40
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 954 1601 4.0E-40
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2779 3391 4.0E-40
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2779 3391 5.0E-40
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2777 3386 8.0E-40
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2778 3386 9.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 991 1623 3.0E-39
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2593 3391 4.0E-39
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1011 1633 5.0E-39
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2709 3378 2.0E-38
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2709 3378 4.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2798 3387 4.0E-38
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2787 3293 8.0E-38
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2787 3293 8.0E-38
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2791 3293 8.0E-38
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2783 3295 1.0E-37
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2781 3295 1.0E-37
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2791 3293 2.0E-37
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2791 3293 2.0E-37
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2697 3391 3.0E-37
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2791 3293 3.0E-37
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2791 3293 3.0E-37
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2791 3293 3.0E-37
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2749 3299 4.0E-37
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2428 3382 5.0E-37
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1000 1601 5.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2787 3293 5.0E-37
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1000 1601 6.0E-37
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1028 1711 8.0E-37
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1005 1608 8.0E-37
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1028 1699 9.0E-37
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2791 3382 1.0E-36
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2791 3293 2.0E-36
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2787 3293 2.0E-36
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2787 3293 3.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 990 1617 4.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2787 3293 6.0E-36
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2788 3296 2.0E-35
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1001 1603 2.0E-35
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2781 3295 2.0E-35
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2815 3386 8.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1008 1600 1.0E-34
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2788 3296 2.0E-34
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1007 1508 1.0E-33
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1006 1507 2.0E-33
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1007 1507 2.0E-33
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1007 1507 2.0E-33
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1007 1507 2.0E-33
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1015 1510 2.0E-33
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 28 419 3.0E-33
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3068 3386 3.0E-33
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1007 1507 3.0E-33
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1007 1507 3.0E-33
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1007 1507 3.0E-33
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1007 1507 3.0E-33
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1007 1507 3.0E-33
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1007 1509 3.0E-33
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1007 1507 3.0E-33
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1007 1507 5.0E-33
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1007 1507 5.0E-33
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1007 1507 5.0E-33
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1007 1507 6.0E-33
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1015 1510 7.0E-33
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2777 3360 7.0E-33
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1015 1510 9.0E-33
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1015 1510 1.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2787 3296 1.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1015 1510 1.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1015 1510 1.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1015 1510 1.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1015 1510 1.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2787 3296 1.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1015 1510 1.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2778 3293 1.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2778 3293 1.0E-32
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1026 1600 2.0E-32
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1007 1507 2.0E-32
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2625 3199 3.0E-32
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 405 853 3.0E-32
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 991 1507 3.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2778 3293 3.0E-32
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 991 1591 4.0E-32
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1007 1507 6.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2787 3293 6.0E-32
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1007 1509 8.0E-32
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 442 862 1.0E-31
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2775 3295 2.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1005 1507 6.0E-31
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1007 1509 9.0E-31
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2781 3293 9.0E-31
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2787 3293 2.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 410 857 5.0E-30
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2781 3295 5.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2787 3293 6.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2787 3293 6.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2787 3293 1.0E-29
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1015 1507 1.0E-29
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 936 1619 2.0E-29
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2791 3387 3.0E-29
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1027 1599 3.0E-29
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2787 3295 3.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1028 1509 4.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1028 1509 4.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1028 1509 5.0E-29
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2791 3382 7.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1025 1507 8.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1011 1510 1.0E-28
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1011 1510 2.0E-28
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2765 3388 2.0E-28
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2781 3293 2.0E-28
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2781 3293 2.0E-28
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2781 3293 2.0E-28
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2781 3293 2.0E-28
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2781 3293 2.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2778 3388 3.0E-28
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1015 1509 3.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2781 3293 3.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2781 3293 3.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2781 3293 3.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2781 3293 4.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2781 3293 4.0E-28
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1027 1509 5.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2787 3293 6.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 933 1491 6.0E-28
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2783 3293 8.0E-28
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 31 331 2.0E-27
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 443 872 3.0E-27
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1007 1514 3.0E-27
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1015 1509 3.0E-27
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1015 1509 3.0E-27
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2787 3293 3.0E-27
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1005 1507 4.0E-27
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2787 3293 4.0E-27
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2787 3293 4.0E-27
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1027 1507 4.0E-27
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2787 3293 5.0E-27
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2787 3293 5.0E-27
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2787 3293 5.0E-27
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2787 3293 5.0E-27
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1015 1509 7.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1026 1507 1.0E-26
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 440 857 2.0E-26
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1314 1603 2.0E-26
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 10 301 2.0E-26
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 950 1643 2.0E-26
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1028 1507 2.0E-26
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 31 271 4.0E-26
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2697 3204 4.0E-26
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 408 823 2.0E-25
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2784 3293 3.0E-25
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1069 1417 5.0E-25
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1151 1576 6.0E-25
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2783 3295 1.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 21 271 2.0E-23
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1153 1507 3.0E-23
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 31 291 5.0E-23
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1153 1507 6.0E-23
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1153 1507 6.0E-23
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1153 1507 6.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1153 1507 6.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1153 1507 6.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 20 291 9.0E-23
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1153 1507 1.0E-22
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1153 1507 2.0E-22
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1153 1507 2.0E-22
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1153 1507 2.0E-22
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1153 1507 2.0E-22
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1153 1507 2.0E-22
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1130 1575 3.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 399 860 2.0E-21
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1 280 2.0E-21
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1014 1507 2.0E-21
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1014 1507 4.0E-21
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1014 1507 4.0E-21
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1014 1507 4.0E-21
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1014 1507 4.0E-21
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1151 1573 6.0E-21
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2837 3380 7.0E-21
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2911 3199 1.0E-20
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2912 3361 1.0E-20
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1014 1507 3.0E-20
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1014 1507 3.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1065 1573 4.0E-20
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1065 1582 6.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 555 884 1.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2095 2429 1.0E-19
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 24 247 2.0E-19
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2802 3360 2.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2089 2386 4.0E-19
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2930 3361 5.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 454 857 9.0E-19
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 29 291 1.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 557 875 2.0E-18
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 443 878 5.0E-18
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 26 271 1.0E-17
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2094 2416 1.0E-17
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3250 3390 1.0E-17
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 12 292 2.0E-17
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 15 271 2.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 26 291 3.0E-17
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2096 2416 6.0E-17
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2798 3299 8.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 28 274 9.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2094 2416 9.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 271 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 21 251 1.0E-16
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 440 855 1.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 553 875 1.0E-16
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 440 855 2.0E-16
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 442 875 3.0E-16
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1148 1508 3.0E-16
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2068 2416 4.0E-16
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1055 1429 7.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2073 2504 9.0E-16
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2094 2416 1.0E-15
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2802 3296 1.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 27 292 2.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 29 292 3.0E-15
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 29 247 3.0E-15
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 2864 3296 3.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2100 2434 5.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2796 3296 5.0E-15
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1012 1510 6.0E-15
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2931 3297 7.0E-15
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 1147 1429 8.0E-15
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1146 1509 1.0E-14
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1003 1509 1.0E-14
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2095 2457 2.0E-14
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1154 1509 2.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 12 291 3.0E-14
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 406 855 3.0E-14
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2092 2422 4.0E-14
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2796 3299 4.0E-14
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 32 274 6.0E-14
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2092 2472 6.0E-14
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2096 2416 6.0E-14
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1148 1515 7.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1148 1505 7.0E-14
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 441 838 1.0E-13
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2761 3299 1.0E-13
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1154 1509 1.0E-13
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1154 1509 1.0E-13
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1154 1509 1.0E-13
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1154 1509 1.0E-13
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2092 2422 2.0E-13
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2931 3303 2.0E-13
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1154 1509 2.0E-13
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2824 3199 2.0E-13
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1154 1509 2.0E-13
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 32 274 3.0E-13
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 32 274 3.0E-13
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2150 2384 5.0E-13
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2098 2434 5.0E-13
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1146 1509 5.0E-13
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1148 1508 5.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1027 1513 5.0E-13
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2095 2416 6.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2527 2799 6.0E-13
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 442 857 8.0E-13
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2094 2384 8.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1147 1659 8.0E-13
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1148 1508 8.0E-13
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2766 3306 9.0E-13
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 29 271 1.0E-12
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 29 271 1.0E-12
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 2803 3333 1.0E-12
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1149 1508 1.0E-12
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2779 3193 1.0E-12
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2779 3193 1.0E-12
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2092 2384 2.0E-12
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2926 3295 2.0E-12
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1148 1509 2.0E-12
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1148 1509 2.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 466 857 3.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 439 855 3.0E-12
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1148 1509 3.0E-12
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1148 1509 3.0E-12
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1148 1509 3.0E-12
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1148 1509 3.0E-12
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1148 1509 3.0E-12
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1148 1509 3.0E-12
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2928 3295 3.0E-12
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2093 2384 4.0E-12
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 21 246 4.0E-12
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 1148 1509 4.0E-12
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 32 271 5.0E-12
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1144 1510 5.0E-12
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1148 1509 5.0E-12
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1148 1509 5.0E-12
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1148 1509 6.0E-12
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2926 3295 6.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2079 2420 8.0E-12
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1146 1509 8.0E-12
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2796 3299 9.0E-12
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1148 1509 9.0E-12
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 32 292 1.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1151 1601 1.0E-11
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2783 3293 1.0E-11
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1154 1509 1.0E-11
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1154 1509 1.0E-11
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 2800 3297 1.0E-11
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1152 1509 1.0E-11
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1148 1512 1.0E-11
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2784 3297 1.0E-11
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 2783 3295 1.0E-11
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 1146 1509 1.0E-11
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1154 1431 2.0E-11
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2926 3294 2.0E-11
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2782 3295 2.0E-11
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1156 1509 2.0E-11
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2925 3297 2.0E-11
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2782 3295 2.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1007 1508 3.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1144 1508 3.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1144 1508 3.0E-11
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1148 1512 3.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2931 3297 3.0E-11
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 1151 1512 3.0E-11
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2929 3295 3.0E-11
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 2925 3297 3.0E-11
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2093 2384 4.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2826 3199 4.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1154 1448 4.0E-11
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2783 3296 4.0E-11
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1154 1510 4.0E-11
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1146 1509 5.0E-11
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 1140 1507 5.0E-11
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 2802 3296 5.0E-11
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 2803 3333 5.0E-11
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2791 3296 6.0E-11
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2804 3295 6.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1146 1509 6.0E-11
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 2864 3295 6.0E-11
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2783 3296 6.0E-11
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 30 250 7.0E-11
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2791 3296 7.0E-11
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2783 3296 7.0E-11
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2791 3296 8.0E-11
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2791 3296 8.0E-11
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1123 1519 8.0E-11
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 2802 3309 8.0E-11
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 2802 3309 8.0E-11
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2783 3296 8.0E-11
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 31 246 9.0E-11
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2791 3296 9.0E-11
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2087 2429 1.0E-10
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2138 2504 1.0E-10
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 2925 3296 1.0E-10
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2929 3297 1.0E-10
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2802 3296 1.0E-10
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2919 3310 1.0E-10
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2791 3295 1.0E-10
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2783 3296 1.0E-10
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 1149 1508 1.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2098 2420 2.0E-10
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2762 3299 2.0E-10
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 2925 3296 2.0E-10
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2782 3295 2.0E-10
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2782 3295 2.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2783 3296 2.0E-10
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1028 1508 2.0E-10
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 2788 3297 2.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 2775 3296 2.0E-10
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 2864 3295 2.0E-10
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2791 3296 2.0E-10
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2914 3296 2.0E-10
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2091 2375 3.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 21 246 3.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2096 2506 3.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2094 2451 4.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 442 693 4.0E-10
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 2925 3296 4.0E-10
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 2802 3308 4.0E-10
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 2911 3293 4.0E-10
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 1152 1512 4.0E-10
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3251 3388 5.0E-10
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 1136 1508 5.0E-10
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 1152 1510 5.0E-10
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1154 1507 5.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2920 3295 5.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2784 3297 5.0E-10
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 1146 1510 6.0E-10
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 2931 3297 6.0E-10
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 2931 3297 6.0E-10
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 2931 3297 6.0E-10
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 2931 3297 6.0E-10
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2927 3303 6.0E-10
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 27 301 7.0E-10
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2898 3289 7.0E-10
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2898 3289 7.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2788 3304 7.0E-10
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2803 3294 7.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2796 3294 7.0E-10
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 1154 1508 7.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1154 1508 7.0E-10
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2898 3289 8.0E-10
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2898 3289 8.0E-10
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2898 3289 8.0E-10
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2783 3296 8.0E-10
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1154 1508 8.0E-10
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3247 3387 9.0E-10
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2898 3289 9.0E-10
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2898 3289 9.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2898 3289 9.0E-10
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2898 3289 9.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2898 3289 9.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2898 3289 9.0E-10
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2084 2380 1.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1005 1509 1.0E-09
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2898 3289 1.0E-09
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2898 3289 1.0E-09
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2779 3299 1.0E-09
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1027 1429 1.0E-09
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2804 3295 1.0E-09
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2931 3294 1.0E-09
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1027 1508 1.0E-09
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1027 1508 1.0E-09
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 1005 1510 1.0E-09
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2138 2418 2.0E-09
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 440 978 2.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2779 3294 2.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2925 3291 2.0E-09
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1001 1508 2.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2931 3299 2.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1154 1429 2.0E-09
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 2931 3297 2.0E-09
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 2931 3297 2.0E-09
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 2803 3199 2.0E-09
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1156 1509 2.0E-09
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2089 2375 3.0E-09
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2090 2463 3.0E-09
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3251 3388 3.0E-09
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2898 3289 3.0E-09
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2803 3299 3.0E-09
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 2931 3296 3.0E-09
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 2931 3296 3.0E-09
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2782 3295 3.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2783 3297 3.0E-09
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2804 3295 3.0E-09
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 1148 1426 3.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 21 246 4.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2931 3299 4.0E-09
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1052 1513 4.0E-09
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2898 3289 5.0E-09
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1144 1508 5.0E-09
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1025 1509 5.0E-09
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2929 3295 5.0E-09
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 2802 3294 5.0E-09
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2898 3289 6.0E-09
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2898 3289 6.0E-09
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1144 1508 6.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2738 3295 6.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2790 3299 6.0E-09
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2898 3289 7.0E-09
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2898 3289 7.0E-09
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2898 3289 7.0E-09
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2802 3294 7.0E-09
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2783 3296 7.0E-09
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 1151 1512 8.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 21 246 1.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2098 2472 1.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2925 3289 1.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2925 3289 1.0E-08
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 2925 3289 1.0E-08
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1154 1512 1.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1144 1508 1.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1144 1508 1.0E-08
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 1141 1503 1.0E-08
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 1141 1503 1.0E-08
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 1141 1503 1.0E-08
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 1141 1503 1.0E-08
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2931 3294 1.0E-08
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 2802 3294 1.0E-08
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2931 3199 1.0E-08
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1146 1509 1.0E-08
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1146 1509 1.0E-08
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 442 745 2.0E-08
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 32 292 2.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2925 3305 2.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2783 3294 2.0E-08
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1154 1508 2.0E-08
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 1152 1513 2.0E-08
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 1152 1513 2.0E-08
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 1152 1513 2.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 2931 3295 2.0E-08
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2079 2416 3.0E-08
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2803 3295 3.0E-08
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 1141 1503 3.0E-08
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 1141 1503 3.0E-08
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 1141 1503 3.0E-08
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 1141 1503 3.0E-08
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2931 3199 3.0E-08
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2931 3303 3.0E-08
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2927 3308 3.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 27 201 4.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 21 301 4.0E-08
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 2931 3199 4.0E-08
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 2931 3199 4.0E-08
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 2787 3297 5.0E-08
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2804 3294 5.0E-08
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2802 3308 5.0E-08
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2096 2376 6.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 29 202 6.0E-08
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1143 1508 6.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2925 3289 7.0E-08
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1146 1509 7.0E-08
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2802 3296 7.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 1151 1520 7.0E-08
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 1152 1512 7.0E-08
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1052 1429 8.0E-08
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 1052 1513 9.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1122 1508 9.0E-08
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2921 3199 9.0E-08
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1154 1508 1.0E-07
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 1152 1512 1.0E-07
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2791 3296 1.0E-07
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 1143 1508 1.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 24 246 2.0E-07
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 741 819 2.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 20 196 2.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2083 2518 2.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2080 2421 2.0E-07
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 40 291 2.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1024 1508 2.0E-07
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2796 3299 2.0E-07
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2930 3306 2.0E-07
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2931 3199 2.0E-07
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2931 3199 2.0E-07
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 1154 1508 2.0E-07
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2931 3199 2.0E-07
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2931 3199 2.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 27 201 3.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 29 196 3.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 430 964 3.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1139 1512 3.0E-07
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1007 1510 3.0E-07
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 2751 3299 3.0E-07
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 1148 1514 3.0E-07
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2931 3199 3.0E-07
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2931 3295 3.0E-07
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2931 3199 3.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 440 758 4.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 27 246 4.0E-07
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1157 1510 4.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2091 2504 5.0E-07
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 26 196 5.0E-07
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 35 198 5.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1139 1512 5.0E-07
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 2931 3295 5.0E-07
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2931 3295 5.0E-07
sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 2800 3297 5.0E-07
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 1027 1517 5.0E-07
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 30 243 6.0E-07
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2925 3295 6.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1156 1429 6.0E-07
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1027 1510 6.0E-07
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2804 3294 6.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 6 268 7.0E-07
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2096 2437 7.0E-07
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2785 3293 7.0E-07
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1146 1466 7.0E-07
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2804 3294 7.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 21 289 8.0E-07
sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 2800 3297 8.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2281 2518 9.0E-07
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 2779 3299 9.0E-07
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2929 3295 9.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3321 3385 1.0E-06
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 27 207 1.0E-06
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 27 207 1.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1154 1510 1.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 2779 3299 1.0E-06
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 2931 3303 1.0E-06
sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=2 2800 3297 1.0E-06
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 2931 3294 1.0E-06
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2083 2504 2.0E-06
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2734 3294 2.0E-06
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1024 1508 2.0E-06
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2882 3294 2.0E-06
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2802 3291 2.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 2792 3148 2.0E-06
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2804 3294 2.0E-06
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2804 3294 2.0E-06
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 2782 2981 2.0E-06
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1154 1460 3.0E-06
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2803 3302 3.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2803 3302 3.0E-06
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1154 1508 3.0E-06
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2804 3294 3.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1405 1603 4.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 21 196 4.0E-06
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 2780 3294 4.0E-06
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2804 3294 4.0E-06
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1154 1511 5.0E-06
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 2931 3294 5.0E-06
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 1154 1509 5.0E-06
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 2783 3287 6.0E-06
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 27 239 7.0E-06
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 2894 3295 7.0E-06
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2804 3294 7.0E-06
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2804 3294 7.0E-06
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2882 3294 8.0E-06
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2882 3294 8.0E-06
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2882 3294 8.0E-06
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 1154 1460 9.0E-06
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1152 1508 9.0E-06
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2804 3294 9.0E-06
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2804 3294 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4066
MGSPSERLTNGLAALSRQGLDSALAEPIEACVQSLIKRHVAERPSAPAICSRDGELGYGQLDVLSSRLACRLALR
PAKPVVLCFEKSLLGPIATLAVIKTGAVAVVLDLEQPPDRLRAIVARLTDPVVISSPTNASLACQLAPGPVVVLD
DDTLSAPVSESAATLPPVSPSDTLCLVFLSNDSDSPTGAAISHRDMSSALVYQQRPLGYAADCRTLDVAPQGSYT
AWCNLLHTWASGGCLCIPSDEDCRSNVWSSAVALRANTIHVTPDVALGLLHNSGPPGRLHLTLVGQPSVVSARYQ
DSSPAQTNHPSEKITALGDGVCAFLTESQCSHSLGRVVGQLRPEGPLFRPGPDPLEILTPPPLASTWSDCCGWTC
SAGDVVRVSGGNFVVRGRSANSVDGEAQSQGRLDSEPSEDSVENMQFSSESEETLETPDAEQVDSAETEQRLLHL
WAQVLQTGSDKISGDDDFFELGGDATKGLRLHALARDKGLHFSLRDLFRGSSLRQLSAQTSRGCLKSAPGIPPFS
LLGPSLNIDEARAQVAQLCRAQTSQVVDLLPCSPLQEGLLALTQRLPGSYVAHHIYEIDEGVSISRLRRAWDQVV
AMNPVLRTRVVSLPSQGLVQVVLEQGAPWSSATDLDDYQSQHCETEKQMGLGTPLSRFAILDAGAEARPCFLWEI
HHALYDGWSLPLVMAEVENAYYCETGQDLKPMTGFIKYIQDRDEMAAKTFWRGQFAGIQEAHFPPPRPAAAASRS
AAQMSLTVPNLGWGRSDFTPATMVRAAWAVVVARGADSNEALYGVTVTGRQAPVDGIELMAGPAIATVPMRVTLD
WEGSVHQLLDSVQRQSTDMIPYEQTGLQRIRRMGDEAAMACAFRSLMVVQPGAGGGGSGGSGGEGDSPSRPFLSK
PDGSGGDDDDQSGRELAPITYPIEVECQLGTDEARLRVDYNPDAVDRREMEAIAESFEQVLRKLADRSLAQEKVG
SLVPGRKGRIDAALAWNATVPQRIEECVHHLIARRVNERPLAPALRAWDGELTYQELDVRSTALALRLVARGVAE
TLVPVLFEKSAWMPVAVLAVLKAGGALVALEMKEPEERLRTIVSQATSPVFLSSVGNAGLARRLAGDEKEVEVVG
GPRNESTDPEPQHALSLLPTVSPSSLLYVVFTSGSTGTPKGVMISHRSFCSAIAYQQAFLDYNQNAHVLDFASCA
FDVAWSNLFNTLTSGACLCIPSPQERENDLAGCFSRYDITFADLTPSVARALGPDVLSRLTTMILGGEAPLPSDA
SLAGGQTHIINAYGPAECTPTSTLTTLDAADVCIGRGLGVCTWIVDVDNSDSLTSVGDVGELWIEGPLVGEGYLN
DAERTAAAFVRDPAWLQHAVGRSGVVYRTGDLVRYRDDGALVFIGRKDTQVKIRGQRVELSEVESCVRQLMDSAD
VQVVAEAIRPPGARNPQLVAFVALPRAEAMADDELDQAAEKATEGLSDRLLQVVPSYMVPATYMPVREMPVTTAG
KTDRRRLRAIGESLWAQYRAHLDKKGKSTQPATEIESILQKVWMSVLNLSADEASVEAGFASMGGDSISAMQLVS
RCRLHNVMFTVSDILQSNTIRKLAALYKPVASTTGSELLRAIENEEQEEPTAEFDLSPMQQSFFRDYPQGLNHFN
QSFLLDLGQDVTARALKGALDALVDRHAMLRARFRRDPDSGIWKQRIEQGPETFAFAEHTVADRDEVGRIGQKRQ
VELDICQGPVFACDLFHVPDGGQVVLLSAHHLVIDLVSWRILWNDVEEYVRLGELQMQKTLSFRSWCAVQAKIGS
SLSPLSVLPYPIPEPELDFWGLSMEDNTFGDCDTLDVSLAPDVSKLLFGKSNESLRTEALDVILGALSYSFHQTF
PERSVPAIWIEGHGREQLEEDVPTDVSGTIGWFTTMYPLAVPITPDQSVTHAVRLVKDTRRKVPRMGLPFYACQH
YSQSGRQAFQGHDVYEIVFNFTGRFQQLEREEGLFKSSQTTDESDVKISEISKSARRFLMLEIGAVVADNALAVS
FNYHRGMKHQDRLLEWSQTFVHVLESAVHLLARAPIGFTLSDLPLLQLSYRGLDSLLTEQLPRIGVKPQNVQSIY
PCSPLQEGMLLSSVKGAASYITYTIWRCISTGPDAEAISPSRLEESWRLVVGRHTILSTVFALHPEGNGFLQIVL
DKPPIRVTQLKSGSESPTETLSRLPEPTFADREPEHALIICRADSGEVACRLDMSHALTDAHSANQLLSELGTAY
SGKGELTPAPAFAEVIRYICSTPRSQIVSTWTSLLDNIKPCEFPSSAVAPDADVQEKLTELACNAELQMSINEFC
KKTEVMPSALIQVAWAMVLSHMTGMHDVCFGYLVSGRDAPVNGVDNVVGPLANLLISRVDLGASARQVLETTSER
SKQHMSIQHVSLAEIQHHLGLSGRRMFNTSLSIRANEKEKGVAESGLSFDILSGGDAHEFDVKCNASIGGADVHL
SIEFREPYVTRRAALEARDTLERAIGYLLANTFVGEGLADVDLDATTLHGGFFKHTTGVENSVATSFWTGQFANT
QGTHFPQPKPSIQHPVLDRSMDLDFGGLGWQSGDYAVETMARSAWSVLAARIMCSDESILGMVSSGSQALDPMPV
RVVVDWEKSVDNLLDEVQCQTLAMKSFGRMGLERIRRVNEDAALACGFQTLLTVDESSQTMGATNSREHGTHSLE
IALRWEAEAVRISAKFDSRVLNEVRVSRLVHQFEHVLRQMLDTDMRQSKLRQMTVASTRDLEDVWTWNAKVPESV
VGCIHDDILENAETRPEAPAIDAWDGSLTYKQLDEVSRKLAVKLIKSGVGSGSIVPLCFEKSMWMPVAALAVMRA
GGASVAVDTTQPQERIRTMTTQVFAALDRPKIILSSVANEVMVGQLEADEVIVVNHDACNDVGVEQAPEMPVVVP
SHVLYVVFTSGSTGKPKGVVITHQNFYTATHYQRTLLGVKSDSRVFDFSSYAFDVAWLSMLKALTVGACLCIASA
AEREDDLGGCLTKYGITVVDLTPAVARVIEPREALSSLDTLILGGEAVSASDADLVGDKTQIMVAYGPAECTPTC
SIMNLTKTKSHGIGHGVGMCLWVVDLENVDALAPVGSTGELWLEGPLVGLGYLNEPEKTAAAFIQDPAWLTKGSP
DGRRPGRRGRVYRTGDLVQQLEDGSFLFIGRKDTQVKIRGQRVELGDIEYHVRQTLEESGTLGKVHVAAETIHPR
GVAGKMLVAFVAAEGTTAETHDDEVRKAAGAATEKLTKALPVYMVPTLYMPVKALPMSATGKIDRRRLQEMGAAL
TAKDVAAMSRAGEQRRTPQTEAERTMQALWAEILNVEAESIGADDSFFRIGGDSIGAMRLVGLARYRGFNFSVRD
VFQSPVLSDLAALESR
Coding >Ophio5|4066
ATGGGCTCGCCTTCAGAGCGACTGACGAACGGCTTGGCTGCCCTGTCCCGGCAAGGCCTCGACTCTGCCCTGGCC
GAACCGATAGAGGCATGCGTCCAGAGCCTCATCAAGCGTCACGTCGCCGAACGCCCTTCTGCCCCGGCCATCTGC
TCTCGGGATGGAGAGCTCGGATACGGGCAGCTCGATGTGCTGTCTAGTCGTCTGGCCTGTCGATTGGCCCTTCGT
CCGGCCAAGCCTGTCGTTCTGTGCTTCGAAAAGTCTCTGCTTGGTCCCATCGCCACCCTGGCCGTCATCAAGACG
GGCGCTGTCGCCGTTGTCCTGGACCTCGAGCAGCCCCCGGACCGCCTCCGTGCCATTGTCGCCCGCCTGACTGAC
CCCGTCGTCATATCTTCCCCGACCAATGCCTCCTTGGCCTGCCAGCTCGCCCCAGGGCCCGTCGTTGTTCTGGAT
GATGATACGCTGTCTGCTCCGGTCTCGGAGTCGGCGGCTACCCTTCCGCCAGTCAGCCCTTCTGACACCCTCTGT
TTAGTCTTTCTGTCCAACGACTCAGACAGTCCGACGGGAGCTGCCATTTCCCACCGAGACATGAGCAGCGCCCTT
GTCTATCAACAAAGGCCTCTTGGATACGCGGCTGACTGCCGCACTCTCGATGTCGCCCCTCAGGGGTCTTACACT
GCTTGGTGTAACCTACTCCACACATGGGCCAGCGGCGGCTGCCTGTGCATCCCGTCTGACGAAGACTGCCGAAGC
AACGTCTGGAGCTCTGCCGTGGCGCTACGGGCCAATACGATTCACGTGACGCCGGACGTGGCTCTCGGCCTGCTC
CACAATTCGGGGCCGCCCGGTCGGCTGCACCTTACCCTGGTGGGGCAGCCATCGGTCGTCTCCGCCCGATACCAA
GACTCTTCCCCGGCACAGACAAACCACCCTTCTGAGAAAATCACCGCCCTAGGCGACGGAGTCTGTGCTTTTCTG
ACTGAATCGCAATGTTCACACTCTCTTGGCCGTGTCGTGGGCCAGCTCCGACCCGAGGGTCCGCTGTTCAGGCCG
GGACCAGACCCTCTCGAAATATTGACTCCGCCGCCGCTCGCCTCCACCTGGTCCGACTGCTGCGGTTGGACGTGC
TCCGCTGGAGACGTCGTGCGAGTCTCCGGCGGCAACTTTGTCGTGCGTGGCAGGTCCGCCAACTCTGTCGATGGA
GAGGCACAAAGCCAGGGCCGGCTGGACAGCGAGCCGTCTGAGGACAGCGTTGAGAATATGCAGTTCTCGTCGGAG
AGCGAGGAGACGCTTGAGACTCCCGATGCCGAACAGGTCGATTCCGCGGAGACGGAGCAACGGTTACTACACTTA
TGGGCCCAAGTCCTCCAAACCGGCTCGGATAAGATCTCCGGTGATGACGACTTCTTCGAGCTCGGCGGCGATGCC
ACAAAGGGTTTGCGCCTTCACGCCTTGGCCCGTGACAAGGGCCTTCACTTCTCCTTGCGTGACCTCTTCCGTGGC
TCCAGCCTTCGTCAGCTTTCGGCCCAGACGAGCCGGGGTTGTCTGAAATCGGCTCCGGGCATCCCCCCTTTCTCC
CTGCTGGGTCCCTCCCTCAATATCGACGAGGCGCGTGCCCAGGTCGCTCAGTTGTGCCGCGCTCAGACCTCTCAG
GTCGTTGACCTGCTTCCCTGCTCACCTCTTCAGGAGGGTTTGCTGGCCCTTACACAGAGGCTTCCGGGCAGCTAC
GTGGCGCATCACATCTACGAGATTGACGAAGGCGTTAGCATATCACGCCTGCGCCGCGCCTGGGATCAGGTTGTG
GCCATGAACCCCGTCCTTCGCACGCGCGTCGTTAGTCTACCCAGTCAAGGCCTCGTCCAGGTTGTCTTGGAGCAA
GGAGCCCCATGGTCGTCGGCCACCGATCTCGACGACTACCAGAGCCAGCACTGCGAGACGGAGAAGCAGATGGGA
CTGGGCACACCCCTTTCCAGGTTTGCCATACTCGACGCCGGCGCCGAAGCCCGCCCCTGCTTCCTGTGGGAGATT
CACCATGCCTTGTACGATGGATGGTCTCTGCCGCTGGTGATGGCTGAGGTCGAGAACGCGTACTACTGCGAGACC
GGACAAGACCTGAAGCCCATGACGGGCTTCATCAAGTATATCCAGGATCGTGACGAGATGGCCGCCAAGACCTTC
TGGAGAGGCCAGTTCGCCGGCATTCAAGAGGCTCACTTTCCCCCGCCACGGCCAGCGGCGGCAGCTTCGCGGTCG
GCCGCCCAGATGTCCCTGACGGTGCCGAATCTCGGATGGGGCCGCAGTGACTTCACGCCGGCCACAATGGTCCGC
GCCGCTTGGGCTGTGGTGGTGGCTCGCGGTGCCGACTCCAACGAGGCTCTCTACGGCGTCACCGTTACGGGCCGC
CAGGCGCCGGTAGATGGCATCGAGCTCATGGCCGGCCCGGCCATCGCCACCGTGCCTATGAGGGTGACTCTGGAC
TGGGAGGGCAGCGTCCACCAACTACTCGACTCGGTGCAACGACAATCGACAGACATGATTCCCTATGAGCAGACG
GGCCTGCAGCGTATCCGCCGCATGGGCGACGAAGCTGCCATGGCCTGTGCCTTCCGCTCGCTGATGGTGGTGCAG
CCGGGGGCCGGCGGCGGCGGCAGCGGCGGCAGCGGCGGCGAGGGAGACTCTCCCAGCCGCCCCTTCTTGAGCAAG
CCCGACGGCAGCGGCGGTGACGATGACGACCAGTCGGGCCGAGAGCTTGCACCTATTACCTATCCCATCGAAGTC
GAATGCCAACTGGGCACGGACGAAGCCCGGCTGCGCGTCGATTACAACCCTGATGCTGTCGACCGTCGCGAGATG
GAAGCCATAGCCGAGAGTTTCGAGCAGGTCCTTCGAAAGCTCGCGGATCGAAGCCTGGCGCAGGAGAAGGTCGGA
TCCCTAGTTCCCGGTCGAAAGGGCCGCATCGACGCTGCTCTCGCCTGGAACGCCACTGTTCCCCAGCGGATCGAG
GAGTGCGTGCATCATCTCATTGCTCGCCGGGTCAACGAGCGTCCGCTGGCCCCTGCTCTCCGCGCCTGGGATGGC
GAGCTCACGTACCAGGAACTTGACGTACGATCGACGGCGCTGGCTCTTCGGCTCGTGGCTCGAGGAGTCGCGGAG
ACGCTGGTGCCGGTGCTGTTCGAGAAGTCGGCGTGGATGCCCGTCGCCGTGCTCGCCGTATTGAAAGCCGGCGGT
GCCTTGGTGGCGTTGGAGATGAAGGAACCGGAAGAGAGACTGCGTACCATTGTTTCACAGGCGACATCGCCGGTC
TTTCTTTCATCAGTCGGCAATGCCGGTCTGGCTCGCCGCCTGGCCGGAGACGAAAAGGAGGTCGAAGTTGTCGGC
GGCCCGAGAAACGAGTCGACGGATCCGGAGCCGCAGCACGCCCTTTCCCTTCTCCCTACGGTCAGCCCGTCCAGC
CTGCTCTATGTTGTCTTTACATCCGGCAGCACGGGGACGCCCAAAGGCGTTATGATCTCACACCGAAGCTTTTGC
AGCGCCATTGCCTATCAGCAGGCATTCTTGGACTATAATCAGAACGCCCATGTCCTAGACTTTGCATCTTGTGCG
TTTGACGTCGCTTGGTCGAACCTTTTTAATACCCTTACCTCTGGTGCCTGCCTCTGCATCCCTTCGCCTCAAGAG
CGGGAGAATGACCTGGCCGGTTGCTTCTCTAGATACGACATTACTTTTGCCGATCTCACCCCGTCGGTTGCTCGG
GCTCTCGGCCCCGATGTGCTCTCGAGGCTGACGACGATGATACTGGGCGGCGAGGCACCGTTGCCGAGTGATGCC
TCGCTGGCTGGTGGCCAGACGCACATCATTAACGCGTACGGCCCGGCCGAGTGTACGCCAACCAGCACACTCACG
ACGCTAGATGCCGCCGACGTTTGCATCGGTCGAGGGCTCGGCGTCTGCACCTGGATCGTCGACGTCGACAATTCC
GATTCGTTGACCTCGGTCGGTGACGTCGGCGAGCTTTGGATCGAGGGACCGCTTGTGGGCGAAGGCTACCTCAAT
GATGCTGAGAGGACGGCGGCGGCCTTTGTTCGAGATCCGGCTTGGCTCCAACACGCCGTCGGCCGGAGCGGTGTC
GTGTATCGCACTGGCGACCTCGTGCGGTACAGGGACGACGGGGCACTCGTCTTCATCGGACGCAAGGACACGCAG
GTCAAGATCCGCGGCCAGCGCGTCGAGCTGAGCGAGGTTGAGAGCTGTGTGCGGCAGCTGATGGACTCTGCCGAC
GTTCAGGTCGTTGCCGAGGCCATCCGACCCCCCGGCGCTCGAAACCCCCAGCTCGTGGCGTTTGTCGCCCTTCCA
AGGGCTGAGGCCATGGCCGACGACGAGCTCGACCAGGCGGCGGAGAAAGCCACCGAAGGGCTTTCGGACCGGCTG
CTCCAGGTAGTGCCGTCTTACATGGTTCCAGCTACCTACATGCCGGTGCGGGAGATGCCGGTCACGACAGCCGGC
AAGACAGACCGACGCCGGCTTCGGGCCATCGGAGAGTCCTTGTGGGCGCAATATCGCGCTCATCTTGACAAGAAG
GGCAAGTCGACGCAGCCTGCCACCGAGATTGAGAGCATCTTGCAAAAGGTGTGGATGTCGGTGCTCAATCTGTCT
GCTGATGAAGCCTCGGTCGAAGCGGGCTTTGCGAGCATGGGCGGAGATTCCATCTCGGCTATGCAGCTGGTGTCC
CGCTGTCGACTGCACAACGTCATGTTCACCGTCAGCGATATTCTTCAGTCCAACACCATTCGCAAGCTCGCAGCC
CTGTACAAGCCCGTTGCCTCCACCACTGGGAGCGAGCTGCTGAGGGCGATCGAGAACGAGGAGCAAGAGGAGCCG
ACGGCCGAATTTGATCTCTCGCCGATGCAGCAGTCCTTCTTCCGCGACTATCCTCAAGGCCTGAACCACTTCAAC
CAGTCTTTCCTCCTCGACCTCGGCCAAGATGTGACAGCTCGAGCGTTGAAGGGTGCCCTTGACGCTCTTGTTGAC
CGTCACGCCATGCTCCGGGCTCGCTTCCGTCGAGACCCCGACAGCGGTATCTGGAAGCAGAGGATTGAGCAGGGC
CCCGAAACGTTCGCCTTTGCCGAGCACACCGTGGCGGATCGCGACGAGGTCGGCAGGATCGGCCAAAAGCGGCAG
GTTGAGCTCGACATCTGCCAGGGCCCAGTCTTTGCTTGCGACCTCTTCCACGTACCCGACGGCGGCCAGGTCGTG
CTTCTCTCGGCGCATCACCTAGTCATCGACCTGGTGTCGTGGCGAATTCTGTGGAACGACGTCGAAGAGTACGTC
AGGCTCGGAGAGCTGCAGATGCAAAAGACGCTTTCTTTCCGCTCGTGGTGCGCAGTGCAAGCCAAGATCGGCAGC
AGCCTTTCCCCCCTCTCCGTGTTGCCTTATCCGATTCCCGAGCCGGAGCTGGACTTCTGGGGGCTGTCGATGGAG
GATAATACATTTGGCGATTGTGATACGCTCGACGTGAGTCTTGCCCCCGACGTGAGCAAGCTTCTATTTGGGAAG
AGCAACGAAAGCCTCCGCACGGAAGCTCTCGATGTCATCCTCGGCGCCCTTTCCTATTCCTTCCACCAGACGTTC
CCGGAGCGATCTGTGCCCGCCATCTGGATCGAGGGTCATGGAAGGGAGCAGCTCGAGGAGGATGTCCCGACCGAC
GTCTCGGGCACCATCGGCTGGTTTACTACCATGTACCCTCTGGCTGTTCCCATCACCCCTGATCAGTCCGTGACA
CACGCTGTGAGACTGGTCAAGGATACGAGGAGGAAGGTTCCTCGCATGGGTTTGCCATTCTACGCCTGTCAACAC
TACAGCCAGTCCGGGCGCCAGGCGTTCCAAGGCCACGATGTCTACGAGATCGTCTTTAATTTTACCGGGCGGTTC
CAGCAGCTGGAGAGAGAGGAGGGCCTGTTCAAGTCTTCTCAGACGACGGACGAAAGCGACGTCAAGATTAGCGAA
ATCTCAAAGTCGGCTCGACGCTTCCTCATGCTCGAGATCGGTGCCGTCGTGGCCGACAACGCCCTCGCCGTCTCC
TTCAACTACCACAGGGGCATGAAGCATCAGGATCGGCTCCTGGAATGGTCGCAGACGTTTGTCCATGTTTTGGAG
TCTGCCGTGCATCTCCTTGCGCGTGCCCCTATCGGCTTCACGTTGAGCGACCTGCCCCTTCTCCAGCTTTCTTAC
CGTGGCCTCGACTCCCTGCTGACGGAGCAACTACCGCGAATCGGGGTCAAGCCGCAAAACGTTCAGAGCATCTAT
CCCTGCTCGCCTCTGCAAGAGGGCATGTTGTTGAGTTCGGTCAAGGGCGCAGCGTCGTACATCACCTACACCATC
TGGCGCTGCATCTCTACTGGCCCCGACGCAGAAGCCATCTCGCCCTCGAGGTTGGAGGAATCTTGGAGGCTTGTG
GTCGGTCGACATACCATTCTCTCCACCGTCTTTGCCCTGCACCCCGAGGGCAACGGCTTTCTGCAGATCGTTCTG
GACAAGCCGCCGATCCGGGTGACGCAGTTGAAATCCGGCTCGGAGAGTCCAACGGAGACCTTGTCCCGCTTGCCG
GAGCCGACGTTTGCCGACCGGGAGCCCGAGCATGCCTTGATTATCTGTCGGGCAGATTCGGGTGAGGTGGCTTGC
CGGCTGGACATGAGCCACGCCTTGACCGATGCCCATTCTGCCAACCAGCTGCTGAGTGAGCTGGGCACGGCATAC
AGCGGCAAAGGCGAGTTGACGCCGGCTCCGGCGTTTGCCGAGGTCATTCGTTACATTTGCAGCACGCCGCGCTCG
CAGATCGTCAGCACGTGGACTTCTCTGCTCGACAACATCAAGCCGTGCGAATTCCCCTCATCGGCCGTGGCTCCC
GATGCCGACGTGCAGGAGAAGCTTACCGAGCTGGCCTGCAACGCGGAACTGCAGATGAGCATCAACGAGTTTTGC
AAGAAGACGGAGGTGATGCCGTCCGCCCTGATTCAGGTTGCTTGGGCCATGGTTCTGTCCCACATGACTGGCATG
CACGACGTCTGCTTCGGCTATCTGGTCTCCGGCCGGGACGCGCCGGTGAATGGAGTGGACAACGTCGTCGGGCCG
CTGGCGAATCTTCTCATCAGTCGGGTGGACTTGGGCGCATCGGCGAGACAGGTGCTCGAGACGACGTCTGAAAGA
TCGAAGCAGCACATGTCGATTCAGCACGTCTCTTTGGCCGAGATCCAGCACCACCTCGGTCTTTCAGGACGACGG
ATGTTTAATACTTCGTTGTCGATTCGCGCCAACGAGAAGGAGAAGGGTGTGGCCGAGTCGGGCCTGTCGTTTGAC
ATTCTGTCCGGAGGCGACGCACACGAGTTTGACGTCAAGTGCAACGCCTCCATAGGGGGCGCTGATGTGCATCTG
TCCATCGAGTTCAGGGAGCCGTACGTAACCAGGCGTGCGGCTTTGGAAGCACGGGATACGCTTGAGCGTGCCATC
GGCTATCTCCTCGCCAACACCTTCGTCGGGGAAGGCCTTGCTGACGTCGACTTGGACGCCACGACTCTCCATGGC
GGCTTCTTCAAGCACACAACGGGAGTGGAAAATTCTGTCGCCACGTCGTTTTGGACGGGCCAGTTTGCCAACACC
CAAGGAACACATTTCCCCCAGCCCAAGCCCAGCATCCAACACCCTGTGCTTGACCGGTCCATGGATTTGGATTTC
GGAGGCCTTGGCTGGCAATCTGGTGACTATGCGGTCGAGACGATGGCCAGGAGCGCTTGGTCTGTCCTGGCTGCT
CGAATCATGTGTTCAGACGAGAGTATCCTGGGGATGGTGAGCTCCGGCAGTCAAGCGCTGGATCCTATGCCCGTC
CGCGTCGTGGTCGACTGGGAGAAGAGCGTCGACAATCTCTTGGACGAGGTGCAATGCCAGACGTTGGCGATGAAG
TCGTTTGGGCGGATGGGCCTGGAGCGAATCCGCCGCGTCAACGAGGATGCGGCATTGGCGTGCGGCTTTCAGACG
CTGCTGACGGTTGATGAGTCGAGCCAGACGATGGGCGCAACCAACAGCCGCGAGCACGGCACGCACTCGTTGGAA
ATTGCCTTGCGTTGGGAGGCGGAGGCGGTGCGCATCTCGGCCAAGTTCGACTCTCGAGTCCTTAACGAAGTGCGA
GTTTCCCGCCTCGTCCACCAGTTCGAGCACGTTCTGCGACAGATGCTCGACACGGATATGCGGCAGAGCAAGCTC
AGACAAATGACGGTGGCAAGCACTCGAGATCTCGAGGACGTCTGGACTTGGAACGCCAAAGTGCCGGAGTCGGTG
GTGGGCTGTATCCACGATGATATCCTGGAGAATGCCGAGACTCGGCCTGAGGCGCCGGCCATTGACGCATGGGAC
GGTAGCTTGACGTATAAGCAGCTGGATGAGGTCTCGCGGAAACTAGCCGTCAAGCTCATCAAGAGCGGCGTTGGC
TCGGGAAGCATCGTGCCGCTCTGTTTCGAGAAGTCCATGTGGATGCCGGTGGCGGCGCTCGCGGTCATGAGAGCG
GGCGGCGCGTCGGTGGCAGTTGACACGACTCAGCCGCAGGAGCGGATACGGACCATGACGACGCAGGTCTTTGCT
GCCTTGGACAGGCCCAAGATCATTCTGTCGTCGGTGGCAAACGAAGTCATGGTGGGACAACTCGAGGCTGACGAG
GTCATCGTCGTCAACCACGACGCATGCAACGACGTCGGTGTCGAGCAAGCCCCTGAGATGCCCGTCGTCGTCCCC
TCGCATGTGCTGTACGTCGTCTTCACCTCGGGGAGTACCGGGAAGCCCAAAGGCGTCGTCATCACCCACCAGAAC
TTTTACACGGCGACGCACTATCAACGCACCCTACTCGGGGTCAAGAGCGACTCGCGCGTGTTCGACTTTTCGTCG
TACGCCTTCGATGTTGCTTGGCTGAGTATGCTGAAGGCGCTCACCGTCGGGGCCTGTCTCTGCATCGCGTCCGCC
GCGGAGCGAGAAGACGATCTCGGCGGCTGTCTGACGAAATACGGCATCACCGTGGTGGATCTGACGCCTGCGGTT
GCGCGGGTCATAGAGCCTCGCGAGGCCCTCTCCAGCCTCGATACCCTTATCCTCGGCGGCGAGGCTGTTTCCGCG
AGCGATGCCGACCTGGTGGGAGACAAGACGCAGATTATGGTGGCCTACGGACCCGCGGAATGCACACCGACCTGT
TCCATCATGAACTTGACCAAGACTAAAAGTCACGGAATCGGCCACGGGGTCGGCATGTGTCTCTGGGTGGTTGAT
CTCGAGAACGTAGACGCGCTGGCTCCGGTCGGTTCTACGGGCGAGCTCTGGCTCGAAGGACCTCTGGTCGGCCTG
GGTTACCTTAACGAGCCGGAGAAGACGGCGGCGGCGTTCATTCAAGACCCGGCATGGCTTACCAAGGGCTCGCCC
GACGGGAGGAGGCCCGGTCGTCGCGGTCGTGTCTATCGGACGGGCGACCTGGTGCAGCAGCTGGAAGATGGGTCT
TTCCTCTTCATCGGGCGCAAGGACACGCAAGTCAAGATCCGCGGACAGCGAGTCGAGCTCGGCGATATCGAGTAC
CACGTCCGCCAGACGCTAGAGGAGTCCGGAACGTTGGGCAAGGTGCATGTGGCGGCCGAGACGATCCACCCGCGA
GGGGTAGCCGGCAAGATGCTGGTTGCTTTCGTGGCAGCCGAGGGCACAACGGCCGAGACGCACGATGACGAGGTC
CGGAAGGCGGCCGGCGCGGCAACGGAGAAGCTGACCAAGGCGCTGCCCGTCTATATGGTGCCGACGCTTTACATG
CCCGTCAAGGCGCTCCCCATGTCAGCCACGGGCAAGATAGACCGACGCCGACTGCAGGAGATGGGCGCGGCGCTG
ACGGCAAAGGACGTTGCGGCCATGAGCCGAGCCGGCGAGCAGAGACGGACGCCGCAGACGGAGGCCGAGCGGACC
ATGCAAGCTCTCTGGGCCGAGATCCTCAATGTTGAAGCGGAGAGTATCGGCGCAGACGACAGCTTCTTCCGCATC
GGCGGCGACTCCATCGGCGCCATGAGGCTGGTGGGCCTGGCGAGGTACAGGGGCTTCAACTTCTCGGTGAGGGAC
GTGTTCCAGAGCCCGGTTTTGAGCGACTTGGCCGCTCTCGAGAGTCGT
Transcript >Ophio5|4066
ATGGGCTCGCCTTCAGAGCGACTGACGAACGGCTTGGCTGCCCTGTCCCGGCAAGGCCTCGACTCTGCCCTGGCC
GAACCGATAGAGGCATGCGTCCAGAGCCTCATCAAGCGTCACGTCGCCGAACGCCCTTCTGCCCCGGCCATCTGC
TCTCGGGATGGAGAGCTCGGATACGGGCAGCTCGATGTGCTGTCTAGTCGTCTGGCCTGTCGATTGGCCCTTCGT
CCGGCCAAGCCTGTCGTTCTGTGCTTCGAAAAGTCTCTGCTTGGTCCCATCGCCACCCTGGCCGTCATCAAGACG
GGCGCTGTCGCCGTTGTCCTGGACCTCGAGCAGCCCCCGGACCGCCTCCGTGCCATTGTCGCCCGCCTGACTGAC
CCCGTCGTCATATCTTCCCCGACCAATGCCTCCTTGGCCTGCCAGCTCGCCCCAGGGCCCGTCGTTGTTCTGGAT
GATGATACGCTGTCTGCTCCGGTCTCGGAGTCGGCGGCTACCCTTCCGCCAGTCAGCCCTTCTGACACCCTCTGT
TTAGTCTTTCTGTCCAACGACTCAGACAGTCCGACGGGAGCTGCCATTTCCCACCGAGACATGAGCAGCGCCCTT
GTCTATCAACAAAGGCCTCTTGGATACGCGGCTGACTGCCGCACTCTCGATGTCGCCCCTCAGGGGTCTTACACT
GCTTGGTGTAACCTACTCCACACATGGGCCAGCGGCGGCTGCCTGTGCATCCCGTCTGACGAAGACTGCCGAAGC
AACGTCTGGAGCTCTGCCGTGGCGCTACGGGCCAATACGATTCACGTGACGCCGGACGTGGCTCTCGGCCTGCTC
CACAATTCGGGGCCGCCCGGTCGGCTGCACCTTACCCTGGTGGGGCAGCCATCGGTCGTCTCCGCCCGATACCAA
GACTCTTCCCCGGCACAGACAAACCACCCTTCTGAGAAAATCACCGCCCTAGGCGACGGAGTCTGTGCTTTTCTG
ACTGAATCGCAATGTTCACACTCTCTTGGCCGTGTCGTGGGCCAGCTCCGACCCGAGGGTCCGCTGTTCAGGCCG
GGACCAGACCCTCTCGAAATATTGACTCCGCCGCCGCTCGCCTCCACCTGGTCCGACTGCTGCGGTTGGACGTGC
TCCGCTGGAGACGTCGTGCGAGTCTCCGGCGGCAACTTTGTCGTGCGTGGCAGGTCCGCCAACTCTGTCGATGGA
GAGGCACAAAGCCAGGGCCGGCTGGACAGCGAGCCGTCTGAGGACAGCGTTGAGAATATGCAGTTCTCGTCGGAG
AGCGAGGAGACGCTTGAGACTCCCGATGCCGAACAGGTCGATTCCGCGGAGACGGAGCAACGGTTACTACACTTA
TGGGCCCAAGTCCTCCAAACCGGCTCGGATAAGATCTCCGGTGATGACGACTTCTTCGAGCTCGGCGGCGATGCC
ACAAAGGGTTTGCGCCTTCACGCCTTGGCCCGTGACAAGGGCCTTCACTTCTCCTTGCGTGACCTCTTCCGTGGC
TCCAGCCTTCGTCAGCTTTCGGCCCAGACGAGCCGGGGTTGTCTGAAATCGGCTCCGGGCATCCCCCCTTTCTCC
CTGCTGGGTCCCTCCCTCAATATCGACGAGGCGCGTGCCCAGGTCGCTCAGTTGTGCCGCGCTCAGACCTCTCAG
GTCGTTGACCTGCTTCCCTGCTCACCTCTTCAGGAGGGTTTGCTGGCCCTTACACAGAGGCTTCCGGGCAGCTAC
GTGGCGCATCACATCTACGAGATTGACGAAGGCGTTAGCATATCACGCCTGCGCCGCGCCTGGGATCAGGTTGTG
GCCATGAACCCCGTCCTTCGCACGCGCGTCGTTAGTCTACCCAGTCAAGGCCTCGTCCAGGTTGTCTTGGAGCAA
GGAGCCCCATGGTCGTCGGCCACCGATCTCGACGACTACCAGAGCCAGCACTGCGAGACGGAGAAGCAGATGGGA
CTGGGCACACCCCTTTCCAGGTTTGCCATACTCGACGCCGGCGCCGAAGCCCGCCCCTGCTTCCTGTGGGAGATT
CACCATGCCTTGTACGATGGATGGTCTCTGCCGCTGGTGATGGCTGAGGTCGAGAACGCGTACTACTGCGAGACC
GGACAAGACCTGAAGCCCATGACGGGCTTCATCAAGTATATCCAGGATCGTGACGAGATGGCCGCCAAGACCTTC
TGGAGAGGCCAGTTCGCCGGCATTCAAGAGGCTCACTTTCCCCCGCCACGGCCAGCGGCGGCAGCTTCGCGGTCG
GCCGCCCAGATGTCCCTGACGGTGCCGAATCTCGGATGGGGCCGCAGTGACTTCACGCCGGCCACAATGGTCCGC
GCCGCTTGGGCTGTGGTGGTGGCTCGCGGTGCCGACTCCAACGAGGCTCTCTACGGCGTCACCGTTACGGGCCGC
CAGGCGCCGGTAGATGGCATCGAGCTCATGGCCGGCCCGGCCATCGCCACCGTGCCTATGAGGGTGACTCTGGAC
TGGGAGGGCAGCGTCCACCAACTACTCGACTCGGTGCAACGACAATCGACAGACATGATTCCCTATGAGCAGACG
GGCCTGCAGCGTATCCGCCGCATGGGCGACGAAGCTGCCATGGCCTGTGCCTTCCGCTCGCTGATGGTGGTGCAG
CCGGGGGCCGGCGGCGGCGGCAGCGGCGGCAGCGGCGGCGAGGGAGACTCTCCCAGCCGCCCCTTCTTGAGCAAG
CCCGACGGCAGCGGCGGTGACGATGACGACCAGTCGGGCCGAGAGCTTGCACCTATTACCTATCCCATCGAAGTC
GAATGCCAACTGGGCACGGACGAAGCCCGGCTGCGCGTCGATTACAACCCTGATGCTGTCGACCGTCGCGAGATG
GAAGCCATAGCCGAGAGTTTCGAGCAGGTCCTTCGAAAGCTCGCGGATCGAAGCCTGGCGCAGGAGAAGGTCGGA
TCCCTAGTTCCCGGTCGAAAGGGCCGCATCGACGCTGCTCTCGCCTGGAACGCCACTGTTCCCCAGCGGATCGAG
GAGTGCGTGCATCATCTCATTGCTCGCCGGGTCAACGAGCGTCCGCTGGCCCCTGCTCTCCGCGCCTGGGATGGC
GAGCTCACGTACCAGGAACTTGACGTACGATCGACGGCGCTGGCTCTTCGGCTCGTGGCTCGAGGAGTCGCGGAG
ACGCTGGTGCCGGTGCTGTTCGAGAAGTCGGCGTGGATGCCCGTCGCCGTGCTCGCCGTATTGAAAGCCGGCGGT
GCCTTGGTGGCGTTGGAGATGAAGGAACCGGAAGAGAGACTGCGTACCATTGTTTCACAGGCGACATCGCCGGTC
TTTCTTTCATCAGTCGGCAATGCCGGTCTGGCTCGCCGCCTGGCCGGAGACGAAAAGGAGGTCGAAGTTGTCGGC
GGCCCGAGAAACGAGTCGACGGATCCGGAGCCGCAGCACGCCCTTTCCCTTCTCCCTACGGTCAGCCCGTCCAGC
CTGCTCTATGTTGTCTTTACATCCGGCAGCACGGGGACGCCCAAAGGCGTTATGATCTCACACCGAAGCTTTTGC
AGCGCCATTGCCTATCAGCAGGCATTCTTGGACTATAATCAGAACGCCCATGTCCTAGACTTTGCATCTTGTGCG
TTTGACGTCGCTTGGTCGAACCTTTTTAATACCCTTACCTCTGGTGCCTGCCTCTGCATCCCTTCGCCTCAAGAG
CGGGAGAATGACCTGGCCGGTTGCTTCTCTAGATACGACATTACTTTTGCCGATCTCACCCCGTCGGTTGCTCGG
GCTCTCGGCCCCGATGTGCTCTCGAGGCTGACGACGATGATACTGGGCGGCGAGGCACCGTTGCCGAGTGATGCC
TCGCTGGCTGGTGGCCAGACGCACATCATTAACGCGTACGGCCCGGCCGAGTGTACGCCAACCAGCACACTCACG
ACGCTAGATGCCGCCGACGTTTGCATCGGTCGAGGGCTCGGCGTCTGCACCTGGATCGTCGACGTCGACAATTCC
GATTCGTTGACCTCGGTCGGTGACGTCGGCGAGCTTTGGATCGAGGGACCGCTTGTGGGCGAAGGCTACCTCAAT
GATGCTGAGAGGACGGCGGCGGCCTTTGTTCGAGATCCGGCTTGGCTCCAACACGCCGTCGGCCGGAGCGGTGTC
GTGTATCGCACTGGCGACCTCGTGCGGTACAGGGACGACGGGGCACTCGTCTTCATCGGACGCAAGGACACGCAG
GTCAAGATCCGCGGCCAGCGCGTCGAGCTGAGCGAGGTTGAGAGCTGTGTGCGGCAGCTGATGGACTCTGCCGAC
GTTCAGGTCGTTGCCGAGGCCATCCGACCCCCCGGCGCTCGAAACCCCCAGCTCGTGGCGTTTGTCGCCCTTCCA
AGGGCTGAGGCCATGGCCGACGACGAGCTCGACCAGGCGGCGGAGAAAGCCACCGAAGGGCTTTCGGACCGGCTG
CTCCAGGTAGTGCCGTCTTACATGGTTCCAGCTACCTACATGCCGGTGCGGGAGATGCCGGTCACGACAGCCGGC
AAGACAGACCGACGCCGGCTTCGGGCCATCGGAGAGTCCTTGTGGGCGCAATATCGCGCTCATCTTGACAAGAAG
GGCAAGTCGACGCAGCCTGCCACCGAGATTGAGAGCATCTTGCAAAAGGTGTGGATGTCGGTGCTCAATCTGTCT
GCTGATGAAGCCTCGGTCGAAGCGGGCTTTGCGAGCATGGGCGGAGATTCCATCTCGGCTATGCAGCTGGTGTCC
CGCTGTCGACTGCACAACGTCATGTTCACCGTCAGCGATATTCTTCAGTCCAACACCATTCGCAAGCTCGCAGCC
CTGTACAAGCCCGTTGCCTCCACCACTGGGAGCGAGCTGCTGAGGGCGATCGAGAACGAGGAGCAAGAGGAGCCG
ACGGCCGAATTTGATCTCTCGCCGATGCAGCAGTCCTTCTTCCGCGACTATCCTCAAGGCCTGAACCACTTCAAC
CAGTCTTTCCTCCTCGACCTCGGCCAAGATGTGACAGCTCGAGCGTTGAAGGGTGCCCTTGACGCTCTTGTTGAC
CGTCACGCCATGCTCCGGGCTCGCTTCCGTCGAGACCCCGACAGCGGTATCTGGAAGCAGAGGATTGAGCAGGGC
CCCGAAACGTTCGCCTTTGCCGAGCACACCGTGGCGGATCGCGACGAGGTCGGCAGGATCGGCCAAAAGCGGCAG
GTTGAGCTCGACATCTGCCAGGGCCCAGTCTTTGCTTGCGACCTCTTCCACGTACCCGACGGCGGCCAGGTCGTG
CTTCTCTCGGCGCATCACCTAGTCATCGACCTGGTGTCGTGGCGAATTCTGTGGAACGACGTCGAAGAGTACGTC
AGGCTCGGAGAGCTGCAGATGCAAAAGACGCTTTCTTTCCGCTCGTGGTGCGCAGTGCAAGCCAAGATCGGCAGC
AGCCTTTCCCCCCTCTCCGTGTTGCCTTATCCGATTCCCGAGCCGGAGCTGGACTTCTGGGGGCTGTCGATGGAG
GATAATACATTTGGCGATTGTGATACGCTCGACGTGAGTCTTGCCCCCGACGTGAGCAAGCTTCTATTTGGGAAG
AGCAACGAAAGCCTCCGCACGGAAGCTCTCGATGTCATCCTCGGCGCCCTTTCCTATTCCTTCCACCAGACGTTC
CCGGAGCGATCTGTGCCCGCCATCTGGATCGAGGGTCATGGAAGGGAGCAGCTCGAGGAGGATGTCCCGACCGAC
GTCTCGGGCACCATCGGCTGGTTTACTACCATGTACCCTCTGGCTGTTCCCATCACCCCTGATCAGTCCGTGACA
CACGCTGTGAGACTGGTCAAGGATACGAGGAGGAAGGTTCCTCGCATGGGTTTGCCATTCTACGCCTGTCAACAC
TACAGCCAGTCCGGGCGCCAGGCGTTCCAAGGCCACGATGTCTACGAGATCGTCTTTAATTTTACCGGGCGGTTC
CAGCAGCTGGAGAGAGAGGAGGGCCTGTTCAAGTCTTCTCAGACGACGGACGAAAGCGACGTCAAGATTAGCGAA
ATCTCAAAGTCGGCTCGACGCTTCCTCATGCTCGAGATCGGTGCCGTCGTGGCCGACAACGCCCTCGCCGTCTCC
TTCAACTACCACAGGGGCATGAAGCATCAGGATCGGCTCCTGGAATGGTCGCAGACGTTTGTCCATGTTTTGGAG
TCTGCCGTGCATCTCCTTGCGCGTGCCCCTATCGGCTTCACGTTGAGCGACCTGCCCCTTCTCCAGCTTTCTTAC
CGTGGCCTCGACTCCCTGCTGACGGAGCAACTACCGCGAATCGGGGTCAAGCCGCAAAACGTTCAGAGCATCTAT
CCCTGCTCGCCTCTGCAAGAGGGCATGTTGTTGAGTTCGGTCAAGGGCGCAGCGTCGTACATCACCTACACCATC
TGGCGCTGCATCTCTACTGGCCCCGACGCAGAAGCCATCTCGCCCTCGAGGTTGGAGGAATCTTGGAGGCTTGTG
GTCGGTCGACATACCATTCTCTCCACCGTCTTTGCCCTGCACCCCGAGGGCAACGGCTTTCTGCAGATCGTTCTG
GACAAGCCGCCGATCCGGGTGACGCAGTTGAAATCCGGCTCGGAGAGTCCAACGGAGACCTTGTCCCGCTTGCCG
GAGCCGACGTTTGCCGACCGGGAGCCCGAGCATGCCTTGATTATCTGTCGGGCAGATTCGGGTGAGGTGGCTTGC
CGGCTGGACATGAGCCACGCCTTGACCGATGCCCATTCTGCCAACCAGCTGCTGAGTGAGCTGGGCACGGCATAC
AGCGGCAAAGGCGAGTTGACGCCGGCTCCGGCGTTTGCCGAGGTCATTCGTTACATTTGCAGCACGCCGCGCTCG
CAGATCGTCAGCACGTGGACTTCTCTGCTCGACAACATCAAGCCGTGCGAATTCCCCTCATCGGCCGTGGCTCCC
GATGCCGACGTGCAGGAGAAGCTTACCGAGCTGGCCTGCAACGCGGAACTGCAGATGAGCATCAACGAGTTTTGC
AAGAAGACGGAGGTGATGCCGTCCGCCCTGATTCAGGTTGCTTGGGCCATGGTTCTGTCCCACATGACTGGCATG
CACGACGTCTGCTTCGGCTATCTGGTCTCCGGCCGGGACGCGCCGGTGAATGGAGTGGACAACGTCGTCGGGCCG
CTGGCGAATCTTCTCATCAGTCGGGTGGACTTGGGCGCATCGGCGAGACAGGTGCTCGAGACGACGTCTGAAAGA
TCGAAGCAGCACATGTCGATTCAGCACGTCTCTTTGGCCGAGATCCAGCACCACCTCGGTCTTTCAGGACGACGG
ATGTTTAATACTTCGTTGTCGATTCGCGCCAACGAGAAGGAGAAGGGTGTGGCCGAGTCGGGCCTGTCGTTTGAC
ATTCTGTCCGGAGGCGACGCACACGAGTTTGACGTCAAGTGCAACGCCTCCATAGGGGGCGCTGATGTGCATCTG
TCCATCGAGTTCAGGGAGCCGTACGTAACCAGGCGTGCGGCTTTGGAAGCACGGGATACGCTTGAGCGTGCCATC
GGCTATCTCCTCGCCAACACCTTCGTCGGGGAAGGCCTTGCTGACGTCGACTTGGACGCCACGACTCTCCATGGC
GGCTTCTTCAAGCACACAACGGGAGTGGAAAATTCTGTCGCCACGTCGTTTTGGACGGGCCAGTTTGCCAACACC
CAAGGAACACATTTCCCCCAGCCCAAGCCCAGCATCCAACACCCTGTGCTTGACCGGTCCATGGATTTGGATTTC
GGAGGCCTTGGCTGGCAATCTGGTGACTATGCGGTCGAGACGATGGCCAGGAGCGCTTGGTCTGTCCTGGCTGCT
CGAATCATGTGTTCAGACGAGAGTATCCTGGGGATGGTGAGCTCCGGCAGTCAAGCGCTGGATCCTATGCCCGTC
CGCGTCGTGGTCGACTGGGAGAAGAGCGTCGACAATCTCTTGGACGAGGTGCAATGCCAGACGTTGGCGATGAAG
TCGTTTGGGCGGATGGGCCTGGAGCGAATCCGCCGCGTCAACGAGGATGCGGCATTGGCGTGCGGCTTTCAGACG
CTGCTGACGGTTGATGAGTCGAGCCAGACGATGGGCGCAACCAACAGCCGCGAGCACGGCACGCACTCGTTGGAA
ATTGCCTTGCGTTGGGAGGCGGAGGCGGTGCGCATCTCGGCCAAGTTCGACTCTCGAGTCCTTAACGAAGTGCGA
GTTTCCCGCCTCGTCCACCAGTTCGAGCACGTTCTGCGACAGATGCTCGACACGGATATGCGGCAGAGCAAGCTC
AGACAAATGACGGTGGCAAGCACTCGAGATCTCGAGGACGTCTGGACTTGGAACGCCAAAGTGCCGGAGTCGGTG
GTGGGCTGTATCCACGATGATATCCTGGAGAATGCCGAGACTCGGCCTGAGGCGCCGGCCATTGACGCATGGGAC
GGTAGCTTGACGTATAAGCAGCTGGATGAGGTCTCGCGGAAACTAGCCGTCAAGCTCATCAAGAGCGGCGTTGGC
TCGGGAAGCATCGTGCCGCTCTGTTTCGAGAAGTCCATGTGGATGCCGGTGGCGGCGCTCGCGGTCATGAGAGCG
GGCGGCGCGTCGGTGGCAGTTGACACGACTCAGCCGCAGGAGCGGATACGGACCATGACGACGCAGGTCTTTGCT
GCCTTGGACAGGCCCAAGATCATTCTGTCGTCGGTGGCAAACGAAGTCATGGTGGGACAACTCGAGGCTGACGAG
GTCATCGTCGTCAACCACGACGCATGCAACGACGTCGGTGTCGAGCAAGCCCCTGAGATGCCCGTCGTCGTCCCC
TCGCATGTGCTGTACGTCGTCTTCACCTCGGGGAGTACCGGGAAGCCCAAAGGCGTCGTCATCACCCACCAGAAC
TTTTACACGGCGACGCACTATCAACGCACCCTACTCGGGGTCAAGAGCGACTCGCGCGTGTTCGACTTTTCGTCG
TACGCCTTCGATGTTGCTTGGCTGAGTATGCTGAAGGCGCTCACCGTCGGGGCCTGTCTCTGCATCGCGTCCGCC
GCGGAGCGAGAAGACGATCTCGGCGGCTGTCTGACGAAATACGGCATCACCGTGGTGGATCTGACGCCTGCGGTT
GCGCGGGTCATAGAGCCTCGCGAGGCCCTCTCCAGCCTCGATACCCTTATCCTCGGCGGCGAGGCTGTTTCCGCG
AGCGATGCCGACCTGGTGGGAGACAAGACGCAGATTATGGTGGCCTACGGACCCGCGGAATGCACACCGACCTGT
TCCATCATGAACTTGACCAAGACTAAAAGTCACGGAATCGGCCACGGGGTCGGCATGTGTCTCTGGGTGGTTGAT
CTCGAGAACGTAGACGCGCTGGCTCCGGTCGGTTCTACGGGCGAGCTCTGGCTCGAAGGACCTCTGGTCGGCCTG
GGTTACCTTAACGAGCCGGAGAAGACGGCGGCGGCGTTCATTCAAGACCCGGCATGGCTTACCAAGGGCTCGCCC
GACGGGAGGAGGCCCGGTCGTCGCGGTCGTGTCTATCGGACGGGCGACCTGGTGCAGCAGCTGGAAGATGGGTCT
TTCCTCTTCATCGGGCGCAAGGACACGCAAGTCAAGATCCGCGGACAGCGAGTCGAGCTCGGCGATATCGAGTAC
CACGTCCGCCAGACGCTAGAGGAGTCCGGAACGTTGGGCAAGGTGCATGTGGCGGCCGAGACGATCCACCCGCGA
GGGGTAGCCGGCAAGATGCTGGTTGCTTTCGTGGCAGCCGAGGGCACAACGGCCGAGACGCACGATGACGAGGTC
CGGAAGGCGGCCGGCGCGGCAACGGAGAAGCTGACCAAGGCGCTGCCCGTCTATATGGTGCCGACGCTTTACATG
CCCGTCAAGGCGCTCCCCATGTCAGCCACGGGCAAGATAGACCGACGCCGACTGCAGGAGATGGGCGCGGCGCTG
ACGGCAAAGGACGTTGCGGCCATGAGCCGAGCCGGCGAGCAGAGACGGACGCCGCAGACGGAGGCCGAGCGGACC
ATGCAAGCTCTCTGGGCCGAGATCCTCAATGTTGAAGCGGAGAGTATCGGCGCAGACGACAGCTTCTTCCGCATC
GGCGGCGACTCCATCGGCGCCATGAGGCTGGTGGGCCTGGCGAGGTACAGGGGCTTCAACTTCTCGGTGAGGGAC
GTGTTCCAGAGCCCGGTTTTGAGCGACTTGGCCGCTCTCGAGAGTCGTTGA
Gene >Ophio5|4066
ATGGGCTCGCCTTCAGAGCGACTGACGAACGGCTTGGCTGCCCTGTCCCGGCAAGGCCTCGACTCTGCCCTGGCC
GAACCGATAGAGGCATGCGTCCAGAGCCTCATCAAGCGTCACGTCGCCGAACGCCCTTCTGCCCCGGCCATCTGC
TCTCGGGATGGAGAGCTCGGATACGGGCAGCTCGATGTGCTGTCTAGTCGTCTGGCCTGTCGATTGGCCCTTCGT
CCGGCCAAGCCTGTCGTTCTGTGCTTCGAAAAGTCTCTGCTTGGTCCCATCGCCACCCTGGCCGTCATCAAGACG
GGCGCTGTCGCCGTTGTCCTGGACCTCGAGCAGCCCCCGGACCGCCTCCGTGCCATTGTCGCCCGCCTGACTGAC
CCCGTCGTCATATCTTCCCCGACCAATGCCTCCTTGGCCTGCCAGCTCGCCCCAGGGCCCGTCGTTGTTCTGGAT
GATGATACGCTGTCTGCTCCGGTCTCGGAGTCGGCGGCTACCCTTCCGCCAGTCAGCCCTTCTGACACCCTCTGT
TTAGTCTTTCTGTCCAACGACTCAGACAGTCCGACGGGAGCTGCCATTTCCCACCGAGACATGAGCAGCGCCCTT
GTCTATCAACAAAGGCCTCTTGGATACGCGGCTGACTGCCGCACTCTCGATGTCGCCCCTCAGGGGTCTTACACT
GCTTGGTGTAACCTACTCCACACATGGGCCAGCGGCGGCTGCCTGTGCATCCCGTCTGACGAAGACTGCCGAAGC
AACGTCTGGAGCTCTGCCGTGGCGCTACGGGCCAATACGATTCACGTGACGCCGGACGTGGCTCTCGGCCTGCTC
CACAATTCGGGGCCGCCCGGTCGGCTGCACCTTACCCTGGTGGGGCAGCCATCGGTCGTCTCCGCCCGATACCAA
GACTCTTCCCCGGCACAGACAAACCACCCTTCTGAGAAAATCACCGCCCTAGGCGACGGAGTCTGTGCTTTTCTG
ACTGAATCGCAATGTTCACACTCTCTTGGCCGTGTCGTGGGCCAGCTCCGACCCGAGGGTCCGCTGTTCAGGCCG
GGACCAGACCCTCTCGAAATATTGACTCCGCCGCCGCTCGCCTCCACCTGGTCCGACTGCTGCGGTTGGACGTGC
TCCGCTGGAGACGTCGTGCGAGTCTCCGGCGGCAACTTTGTCGTGCGTGGCAGGTCCGCCAACTCTGTCGATGGA
GAGGCACAAAGCCAGGGCCGGCTGGACAGCGAGCCGTCTGAGGACAGCGTTGAGAATATGCAGTTCTCGTCGGAG
AGCGAGGAGACGCTTGAGACTCCCGATGCCGAACAGGTCGATTCCGCGGAGACGGAGCAACGGTTACTACACTTA
TGGGCCCAAGTCCTCCAAACCGGCTCGGATAAGATCTCCGGTGATGACGACTTCTTCGAGCTCGGCGGCGATGCC
ACAAAGGGTTTGCGCCTTCACGCCTTGGCCCGTGACAAGGGCCTTCACTTCTCCTTGCGTGACCTCTTCCGTGGC
TCCAGCCTTCGTCAGCTTTCGGCCCAGACGAGCCGGGGTTGTCTGAAATCGGCTCCGGGCATCCCCCCTTTCTCC
CTGCTGGGTCCCTCCCTCAATATCGACGAGGCGCGTGCCCAGGTCGCTCAGTTGTGCCGCGCTCAGACCTCTCAG
GTCGTTGACCTGCTTCCCTGCTCACCTCTTCAGGAGGGTTTGCTGGCCCTTACACAGAGGCTTCCGGGCAGCTAC
GTGGCGCATCACATCTACGAGATTGACGAAGGCGTTAGCATATCACGCCTGCGCCGCGCCTGGGATCAGGTTGTG
GCCATGAACCCCGTCCTTCGCACGCGCGTCGTTAGTCTACCCAGTCAAGGCCTCGTCCAGGTTGTCTTGGAGCAA
GGAGCCCCATGGTCGTCGGCCACCGATCTCGACGACTACCAGAGCCAGCACTGCGAGACGGAGAAGCAGATGGGA
CTGGGCACACCCCTTTCCAGGTTTGCCATACTCGACGCCGGCGCCGAAGCCCGCCCCTGCTTCCTGTGGGAGATT
CACCATGCCTTGTACGATGGATGGTCTCTGCCGCTGGTGATGGCTGAGGTCGAGAACGCGTACTACTGCGAGACC
GGACAAGACCTGAAGCCCATGACGGGCTTCATCAAGTATATCCAGGATCGTGACGAGATGGCCGCCAAGACCTTC
TGGAGAGGCCAGTTCGCCGGCATTCAAGAGGCTCACTTTCCCCCGCCACGGCCAGCGGCGGCAGCTTCGCGGTCG
GCCGCCCAGATGTCCCTGACGGTGCCGAATCTCGGATGGGGCCGCAGTGACTTCACGCCGGCCACAATGGTCCGC
GCCGCTTGGGCTGTGGTGGTGGCTCGCGGTGCCGACTCCAACGAGGCTCTCTACGGCGTCACCGTTACGGGCCGC
CAGGCGCCGGTAGATGGCATCGAGCTCATGGCCGGCCCGGCCATCGCCACCGTGCCTATGAGGGTGACTCTGGAC
TGGGAGGGCAGCGTCCACCAACTACTCGACTCGGTGCAACGACAATCGACAGACATGATTCCCTATGAGCAGACG
GGCCTGCAGCGTATCCGCCGCATGGGCGACGAAGCTGCCATGGCCTGTGCCTTCCGCTCGCTGATGGTGGTGCAG
CCGGGGGCCGGCGGCGGCGGCAGCGGCGGCAGCGGCGGCGAGGGAGACTCTCCCAGCCGCCCCTTCTTGAGCAAG
CCCGACGGCAGCGGCGGTGACGATGACGACCAGTCGGGCCGAGAGCTTGCACCTATTACCTATCCCATCGAAGTC
GAATGCCAACTGGGCACGGACGAAGCCCGGCTGCGCGTCGATTACAACCCTGATGCTGTCGACCGTCGCGAGATG
GAAGCCATAGCCGAGAGTTTCGAGCAGGTCCTTCGAAAGCTCGCGGATCGAAGCCTGGCGCAGGAGAAGGTCGGA
TCCCTAGTTCCCGGTCGAAAGGGCCGCATCGACGCTGCTCTCGCCTGGAACGCCACTGTTCCCCAGCGGATCGAG
GAGTGCGTGCATCATCTCATTGCTCGCCGGGTCAACGAGCGTCCGCTGGCCCCTGCTCTCCGCGCCTGGGATGGC
GAGCTCACGTACCAGGAACTTGACGTACGATCGACGGCGCTGGCTCTTCGGCTCGTGGCTCGAGGAGTCGCGGAG
ACGCTGGTGCCGGTGCTGTTCGAGAAGTCGGCGTGGATGCCCGTCGCCGTGCTCGCCGTATTGAAAGCCGGCGGT
GCCTTGGTGGCGTTGGAGATGAAGGAACCGGAAGAGAGACTGCGTACCATTGTTTCACAGGCGACATCGCCGGTC
TTTCTTTCATCAGTCGGCAATGCCGGTCTGGCTCGCCGCCTGGCCGGAGACGAAAAGGAGGTCGAAGTTGTCGGC
GGCCCGAGAAACGAGTCGACGGATCCGGAGCCGCAGCACGCCCTTTCCCTTCTCCCTACGGTCAGCCCGTCCAGC
CTGCTCTATGTTGTCTTTACATCCGGCAGCACGGGGACGCCCAAAGGCGTTATGATCTCACACCGAAGCTTTTGC
AGCGCCATTGCCTATCAGCAGGCATTCTTGGACTATAATCAGAACGCCCATGTCCTAGACTTTGCATCTTGTGCG
TTTGACGTCGCTTGGTCGAACCTTTTTAATACCCTTACCTCTGGTGCCTGCCTCTGCATCCCTTCGCCTCAAGAG
CGGGAGAATGACCTGGCCGGTTGCTTCTCTAGATACGACATTACTTTTGCCGATCTCACCCCGTCGGTTGCTCGG
GCTCTCGGCCCCGATGTGCTCTCGAGGCTGACGACGATGATACTGGGCGGCGAGGCACCGTTGCCGAGTGATGCC
TCGCTGGCTGGTGGCCAGACGCACATCATTAACGCGTACGGCCCGGCCGAGTGTACGCCAACCAGCACACTCACG
ACGCTAGATGCCGCCGACGTTTGCATCGGTCGAGGGCTCGGCGTCTGCACCTGGATCGTCGACGTCGACAATTCC
GATTCGTTGACCTCGGTCGGTGACGTCGGCGAGCTTTGGATCGAGGGACCGCTTGTGGGCGAAGGCTACCTCAAT
GATGCTGAGAGGACGGCGGCGGCCTTTGTTCGAGATCCGGCTTGGCTCCAACACGCCGTCGGCCGGAGCGGTGTC
GTGTATCGCACTGGCGACCTCGTGCGGTACAGGGACGACGGGGCACTCGTCTTCATCGGACGCAAGGACACGCAG
GTCAAGATCCGCGGCCAGCGCGTCGAGCTGAGCGAGGTTGAGAGCTGTGTGCGGCAGCTGATGGACTCTGCCGAC
GTTCAGGTCGTTGCCGAGGCCATCCGACCCCCCGGCGCTCGAAACCCCCAGCTCGTGGCGTTTGTCGCCCTTCCA
AGGGCTGAGGCCATGGCCGACGACGAGCTCGACCAGGCGGCGGAGAAAGCCACCGAAGGGCTTTCGGACCGGCTG
CTCCAGGTAGTGCCGTCTTACATGGTTCCAGCTACCTACATGCCGGTGCGGGAGATGCCGGTCACGACAGCCGGC
AAGACAGACCGACGCCGGCTTCGGGCCATCGGAGAGTCCTTGTGGGCGCAATATCGCGCTCATCTTGACAAGAAG
GGCAAGTCGACGCAGCCTGCCACCGAGATTGAGAGCATCTTGCAAAAGGTGTGGATGTCGGTGCTCAATCTGTCT
GCTGATGAAGCCTCGGTCGAAGCGGGCTTTGCGAGCATGGGCGGAGATTCCATCTCGGCTATGCAGCTGGTGTCC
CGCTGTCGACTGCACAACGTCATGTTCACCGTCAGCGATATTCTTCAGTCCAACACCATTCGCAAGCTCGCAGCC
CTGTACAAGCCCGTTGCCTCCACCACTGGGAGCGAGCTGCTGAGGGCGATCGAGAACGAGGAGCAAGAGGAGCCG
ACGGCCGAATTTGATCTCTCGCCGATGCAGCAGTCCTTCTTCCGCGACTATCCTCAAGGCCTGAACCACTTCAAC
CAGTCTTTCCTCCTCGACCTCGGCCAAGATGTGACAGCTCGAGCGTTGAAGGGTGCCCTTGACGCTCTTGTTGAC
CGTCACGCCATGCTCCGGGCTCGCTTCCGTCGAGACCCCGACAGCGGTATCTGGAAGCAGAGGATTGAGCAGGGC
CCCGAAACGTTCGCCTTTGCCGAGCACACCGTGGCGGATCGCGACGAGGTCGGCAGGATCGGCCAAAAGCGGCAG
GTTGAGCTCGACATCTGCCAGGGCCCAGTCTTTGCTTGCGACCTCTTCCACGTACCCGACGGCGGCCAGGTCGTG
CTTCTCTCGGCGCATCACCTAGTCATCGACCTGGTGTCGTGGCGAATTCTGTGGAACGACGTCGAAGAGTACGTC
AGGCTCGGAGAGCTGCAGATGCAAAAGACGCTTTCTTTCCGCTCGTGGTGCGCAGTGCAAGCCAAGATCGGCAGC
AGCCTTTCCCCCCTCTCCGTGTTGCCTTATCCGATTCCCGAGCCGGAGCTGGACTTCTGGGGGCTGTCGATGGAG
GATAATACATTTGGCGATTGTGATACGCTCGACGTGAGTCTTGCCCCCGACGTGAGCAAGCTTCTATTTGGGAAG
AGCAACGAAAGCCTCCGCACGGAAGCTCTCGATGTCATCCTCGGCGCCCTTTCCTATTCCTTCCACCAGACGTTC
CCGGAGCGATCTGTGCCCGCCATCTGGATCGAGGGTCATGGAAGGGAGCAGCTCGAGGAGGATGTCCCGACCGAC
GTCTCGGGCACCATCGGCTGGTTTACTACCATGTACCCTCTGGCTGTTCCCATCACCCCTGATCAGTCCGTGACA
CACGCTGTGAGACTGGTCAAGGATACGAGGAGGAAGGTTCCTCGCATGGGTTTGCCATTCTACGCCTGTCAACAC
TACAGCCAGTCCGGGCGCCAGGCGTTCCAAGGCCACGATGTCTACGAGATCGTCTTTAATTTTACCGGGCGGTTC
CAGCAGCTGGAGAGAGAGGAGGGCCTGTTCAAGTCTTCTCAGACGACGGACGAAAGCGACGTCAAGATTAGCGAA
ATCTCAAAGTCGGCTCGACGCTTCCTCATGCTCGAGATCGGTGCCGTCGTGGCCGACAACGCCCTCGCCGTCTCC
TTCAACTACCACAGGGGCATGAAGCATCAGGATCGGCTCCTGGAATGGTCGCAGACGTTTGTCCATGTTTTGGAG
TCTGCCGTGCATCTCCTTGCGCGTGCCCCTATCGGCTTCACGTTGAGCGACCTGCCCCTTCTCCAGCTTTCTTAC
CGTGGCCTCGACTCCCTGCTGACGGAGCAACTACCGCGAATCGGGGTCAAGCCGCAAAACGTTCAGAGCATCTAT
CCCTGCTCGCCTCTGCAAGAGGGCATGTTGTTGAGTTCGGTCAAGGGCGCAGCGTCGTACATCACCTACACCATC
TGGCGCTGCATCTCTACTGGCCCCGACGCAGAAGCCATCTCGCCCTCGAGGTTGGAGGAATCTTGGAGGCTTGTG
GTCGGTCGACATACCATTCTCTCCACCGTCTTTGCCCTGCACCCCGAGGGCAACGGCTTTCTGCAGATCGTTCTG
GACAAGCCGCCGATCCGGGTGACGCAGTTGAAATCCGGCTCGGAGAGTCCAACGGAGACCTTGTCCCGCTTGCCG
GAGCCGACGTTTGCCGACCGGGAGCCCGAGCATGCCTTGATTATCTGTCGGGCAGATTCGGGTGAGGTGGCTTGC
CGGCTGGACATGAGCCACGCCTTGACCGATGCCCATTCTGCCAACCAGCTGCTGAGTGAGCTGGGCACGGCATAC
AGCGGCAAAGGCGAGTTGACGCCGGCTCCGGCGTTTGCCGAGGTCATTCGTTACATTTGCAGCACGCCGCGCTCG
CAGATCGTCAGCACGTGGACTTCTCTGCTCGACAACATCAAGCCGTGCGAATTCCCCTCATCGGCCGTGGCTCCC
GATGCCGACGTGCAGGAGAAGCTTACCGAGCTGGCCTGCAACGCGGAACTGCAGATGAGCATCAACGAGTTTTGC
AAGAAGACGGAGGTGATGCCGTCCGCCCTGATTCAGGTTGCTTGGGCCATGGTTCTGTCCCACATGACTGGCATG
CACGACGTCTGCTTCGGCTATCTGGTCTCCGGCCGGGACGCGCCGGTGAATGGAGTGGACAACGTCGTCGGGCCG
CTGGCGAATCTTCTCATCAGTCGGGTGGACTTGGGCGCATCGGCGAGACAGGTGCTCGAGACGACGTCTGAAAGA
TCGAAGCAGCACATGTCGATTCAGCACGTCTCTTTGGCCGAGATCCAGCACCACCTCGGTCTTTCAGGACGACGG
ATGTTTAATACTTCGTTGTCGATTCGCGCCAACGAGAAGGAGAAGGGTGTGGCCGAGTCGGGCCTGTCGTTTGAC
ATTCTGTCCGGAGGCGACGCACACGAGGTTGGTAGTCGGACTAGATGGCGGATGTGCCAGGACGAGCTGACATTT
TTTTCCCACCGCAGTTTGACGTCAAGTGCAACGCCTCCATAGGGGGCGCTGATGTGCATCTGTCCATCGAGTTCA
GGGAGCCGTACGTAACCAGGCGTGCGGCTTTGGAAGCACGGGATACGCTTGAGCGTGCCATCGGCTATCTCCTCG
CCAACACCTTCGTCGGGGAAGGCCTTGCTGACGTCGACTTGGACGCCACGACTCTCCATGGCGGCTTCTTCAAGC
ACACAACGGGAGTGGAAAATTCTGTCGCCACGTCGTTTTGGACGGGCCAGTTTGCCAACACCCAAGGAACACATT
TCCCCCAGCCCAAGCCCAGCATCCAACACCCTGTGCTTGACCGGTCCATGGATTTGGATTTCGGAGGCCTTGGCT
GGCAATCTGGTGACTATGCGGTCGAGACGATGGCCAGGAGCGCTTGGTCTGTCCTGGCTGCTCGAATCATGTGTT
CAGACGAGAGTATCCTGGGGATGGTGAGCTCCGGCAGTCAAGCGCTGGATCCTATGCCCGTCCGCGTCGTGGTCG
ACTGGGAGAAGAGCGTCGACAATCTCTTGGACGAGGTGCAATGCCAGACGTTGGCGATGAAGTCGTTTGGGCGGA
TGGGCCTGGAGCGAATCCGCCGCGTCAACGAGGATGCGGCATTGGCGTGCGGCTTTCAGACGCTGCTGACGGTTG
ATGAGTCGAGCCAGACGATGGGCGCAACCAACAGCCGCGAGCACGGCACGCACTCGTTGGAAATTGCCTTGCGTT
GGGAGGCGGAGGCGGTGCGCATCTCGGCCAAGTTCGACTCTCGAGTCCTTAACGAAGTGCGAGTTTCCCGCCTCG
TCCACCAGTTCGAGCACGTTCTGCGACAGATGCTCGACACGGATATGCGGCAGAGCAAGCTCAGACAAATGACGG
TGGCAAGCACTCGAGATCTCGAGGACGTCTGGACTTGGAACGCCAAAGTGCCGGAGTCGGTGGTGGGCTGTATCC
ACGATGATATCCTGGAGAATGCCGAGACTCGGCCTGAGGCGCCGGCCATTGACGCATGGGACGGTAGCTTGACGT
ATAAGCAGCTGGATGAGGTCTCGCGGAAACTAGCCGTCAAGCTCATCAAGAGCGGCGTTGGCTCGGGAAGCATCG
TGCCGCTCTGTTTCGAGAAGTCCATGTGGATGCCGGTGGCGGCGCTCGCGGTCATGAGAGCGGGCGGCGCGTCGG
TGGCAGTTGACACGACTCAGCCGCAGGAGCGGATACGGACCATGACGACGCAGGTCTTTGCTGCCTTGGACAGGC
CCAAGATCATTCTGTCGTCGGTGGCAAACGAAGTCATGGTGGGACAACTCGAGGCTGACGAGGTCATCGTCGTCA
ACCACGACGCATGCAACGACGTCGGTGTCGAGCAAGCCCCTGAGATGCCCGTCGTCGTCCCCTCGCATGTGCTGT
ACGTCGTCTTCACCTCGGGGAGTACCGGGAAGCCCAAAGGCGTCGTCATCACCCACCAGAACTTTTACACGGCGA
CGCACTATCAACGCACCCTACTCGGGGTCAAGAGCGACTCGCGCGTGTTCGACTTTTCGTCGTACGCCTTCGATG
TTGCTTGGCTGAGTATGCTGAAGGCGCTCACCGTCGGGGCCTGTCTCTGCATCGCGTCCGCCGCGGAGCGAGAAG
ACGATCTCGGCGGCTGTCTGACGAAATACGGCATCACCGTGGTGGATCTGACGCCTGCGGTTGCGCGGGTCATAG
AGCCTCGCGAGGCCCTCTCCAGCCTCGATACCCTTATCCTCGGCGGCGAGGCTGTTTCCGCGAGCGATGCCGACC
TGGTGGGAGACAAGACGCAGATTATGGTGGCCTACGGACCCGCGGAATGCACACCGACCTGTTCCATCATGAACT
TGACCAAGACTAAAAGTCACGGAATCGGCCACGGGGTCGGCATGTGTCTCTGGGTGGTTGATCTCGAGAACGTAG
ACGCGCTGGCTCCGGTCGGTTCTACGGGCGAGCTCTGGCTCGAAGGACCTCTGGTCGGCCTGGGTTACCTTAACG
AGCCGGAGAAGACGGCGGCGGCGTTCATTCAAGACCCGGCATGGCTTACCAAGGGCTCGCCCGACGGGAGGAGGC
CCGGTCGTCGCGGTCGTGTCTATCGGACGGGCGACCTGGTGCAGCAGCTGGAAGATGGGTCTTTCCTCTTCATCG
GGCGCAAGGACACGCAAGTCAAGATCCGCGGACAGCGAGTCGAGCTCGGCGATATCGAGTACCACGTCCGCCAGA
CGCTAGAGGAGTCCGGAACGTTGGGCAAGGTGCATGTGGCGGCCGAGACGATCCACCCGCGAGGGGTAGCCGGCA
AGATGCTGGTTGCTTTCGTGGCAGCCGAGGGCACAACGGCCGAGACGCACGATGACGAGGTCCGGAAGGCGGCCG
GCGCGGCAACGGAGAAGCTGACCAAGGCGCTGCCCGTCTATATGGTGCCGACGCTTTACATGCCCGTCAAGGCGC
TCCCCATGTCAGCCACGGGCAAGATAGACCGACGCCGACTGCAGGAGATGGGCGCGGCGCTGACGGCAAAGGACG
TTGCGGCCATGAGCCGAGCCGGCGAGCAGAGACGGACGCCGCAGACGGAGGCCGAGCGGACCATGCAAGCTCTCT
GGGCCGAGATCCTCAATGTTGAAGCGGAGAGTATCGGCGCAGACGACAGCTTCTTCCGCATCGGCGGCGACTCCA
TCGGCGCCATGAGGCTGGTGGGCCTGGCGAGGTACAGGGGCTTCAACTTCTCGGTGAGGGACGTGTTCCAGAGCC
CGGTTTTGAGCGACTTGGCCGCTCTCGAGAGTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail