Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4061
Gene name
Locationscaffold_318:362..1256
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14510 ABC_trans_N ABC-transporter N-terminal 3.3E-16 79 165
PF00005 ABC_tran ABC transporter 1.3E-05 196 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 107 257 1.0E-23
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 62 265 3.0E-23
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 107 257 7.0E-23
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 107 257 3.0E-21
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 107 257 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 107 257 1.0E-23
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 62 265 3.0E-23
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 107 257 7.0E-23
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 107 257 3.0E-21
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 107 257 1.0E-18
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 111 262 6.0E-18
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 108 262 8.0E-18
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 111 262 4.0E-17
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 111 262 2.0E-16
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 111 262 2.0E-16
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 116 257 3.0E-15
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 106 257 2.0E-14
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 117 262 3.0E-14
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 115 257 1.0E-12
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 106 257 3.0E-12
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 124 257 2.0E-11
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 124 257 2.0E-11
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 124 257 4.0E-11
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 148 257 3.0E-10
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 124 280 1.0E-09
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 108 257 4.0E-09
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 124 257 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 258 280 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.05 0.0 0.39
CcL In ants, during behavior modification 0.00 0.0 0.00
CcD In ants, recently dead 0.00 0.0 0.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4061
MSNASDQGDERPTAADEIDEDEAEPAAKDFAKDARQGRNLSMVTTRLGEIRSSPGSSLPSPSSACSSSSSMLGED
ERTELVRIATALSRNVASSGSRQGSLLYPVQYEPALDPAHDNFDLSAWLRRFIEQLQEQGITYRRTGVAFRHLDV
LGSGSALQLQSTVGTVLTAPLRLPELLRLGRKREPRHILHGFEGLVRSGELLIVLGRPGSGCSTLLRTLTGELHG
LDLGSDASVHFNGIPLRKMRSEFRGEIIYNQEVSCLFFFILLLLLLLLLFSPLLPCHCVLVLPPFHRSSHRV
Coding >Ophio5|4061
ATGTCGAATGCCTCGGACCAAGGAGACGAGCGGCCGACAGCGGCCGACGAAATCGACGAAGATGAGGCTGAACCG
GCGGCAAAGGACTTCGCCAAGGACGCGCGGCAGGGGAGAAACCTGTCGATGGTGACGACGCGTTTGGGAGAGATA
CGGTCCAGTCCAGGCAGCTCGCTGCCGTCTCCCTCTTCGGCTTGCTCTAGCAGCAGCTCGATGCTGGGAGAGGAC
GAAAGGACGGAGCTGGTGCGTATCGCCACGGCTCTTTCGCGCAACGTCGCCTCGTCTGGTAGCAGGCAGGGCTCG
TTGCTCTACCCGGTTCAGTACGAGCCGGCTCTGGACCCGGCTCACGACAACTTTGACCTCTCGGCTTGGCTGCGG
CGCTTCATCGAGCAGCTCCAGGAGCAGGGCATCACCTACCGACGCACCGGAGTCGCCTTTCGCCATCTCGACGTC
CTGGGCTCCGGCTCTGCGCTGCAACTGCAGTCGACCGTCGGCACCGTCTTGACTGCACCGCTACGTCTGCCGGAA
CTGCTTCGGCTGGGTCGCAAAAGGGAGCCGAGACATATCCTGCATGGGTTCGAGGGCCTCGTCCGTAGCGGCGAG
CTGCTCATTGTGCTCGGACGGCCCGGCTCCGGGTGCAGTACCCTCCTTCGGACGTTGACGGGGGAGCTGCACGGG
CTGGACCTGGGATCCGACGCGAGCGTTCACTTCAATGGCATCCCGCTGAGGAAGATGCGGAGTGAGTTTCGGGGC
GAAATCATCTATAACCAGGAGGTGAGTTGCCTCTTCTTTTTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTC
TCGCCTCTTCTTCCTTGTCATTGTGTCCTTGTTCTTCCCCCTTTCCATCGCTCCTCTCACCGAGTC
Transcript >Ophio5|4061
ATGTCGAATGCCTCGGACCAAGGAGACGAGCGGCCGACAGCGGCCGACGAAATCGACGAAGATGAGGCTGAACCG
GCGGCAAAGGACTTCGCCAAGGACGCGCGGCAGGGGAGAAACCTGTCGATGGTGACGACGCGTTTGGGAGAGATA
CGGTCCAGTCCAGGCAGCTCGCTGCCGTCTCCCTCTTCGGCTTGCTCTAGCAGCAGCTCGATGCTGGGAGAGGAC
GAAAGGACGGAGCTGGTGCGTATCGCCACGGCTCTTTCGCGCAACGTCGCCTCGTCTGGTAGCAGGCAGGGCTCG
TTGCTCTACCCGGTTCAGTACGAGCCGGCTCTGGACCCGGCTCACGACAACTTTGACCTCTCGGCTTGGCTGCGG
CGCTTCATCGAGCAGCTCCAGGAGCAGGGCATCACCTACCGACGCACCGGAGTCGCCTTTCGCCATCTCGACGTC
CTGGGCTCCGGCTCTGCGCTGCAACTGCAGTCGACCGTCGGCACCGTCTTGACTGCACCGCTACGTCTGCCGGAA
CTGCTTCGGCTGGGTCGCAAAAGGGAGCCGAGACATATCCTGCATGGGTTCGAGGGCCTCGTCCGTAGCGGCGAG
CTGCTCATTGTGCTCGGACGGCCCGGCTCCGGGTGCAGTACCCTCCTTCGGACGTTGACGGGGGAGCTGCACGGG
CTGGACCTGGGATCCGACGCGAGCGTTCACTTCAATGGCATCCCGCTGAGGAAGATGCGGAGTGAGTTTCGGGGC
GAAATCATCTATAACCAGGAGGTGAGTTGCCTCTTCTTTTTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTC
TCGCCTCTTCTTCCTTGTCATTGTGTCCTTGTTCTTCCCCCTTTCCATCGCTCCTCTCACCGAGTCTAA
Gene >Ophio5|4061
ATGTCGAATGCCTCGGACCAAGGAGACGAGCGGCCGACAGCGGCCGACGAAATCGACGAAGATGAGGCTGAACCG
GCGGCAAAGGACTTCGCCAAGGACGCGCGGCAGGGGAGAAACCTGTCGATGGTGACGACGCGTTTGGGAGAGATA
CGGTCCAGTCCAGGCAGCTCGCTGCCGTCTCCCTCTTCGGCTTGCTCTAGCAGCAGCTCGATGCTGGGAGAGGAC
GAAAGGACGGAGCTGGTGCGTATCGCCACGGCTCTTTCGCGCAACGTCGCCTCGTCTGGTAGCAGGCAGGGCTCG
TTGCTCTACCCGGTTCAGTACGAGCCGGCTCTGGACCCGGCTCACGACAACTTTGACCTCTCGGCTTGGCTGCGG
CGCTTCATCGAGCAGCTCCAGGAGCAGGGCATCACCTACCGACGCACCGGAGTCGCCTTTCGCCATCTCGACGTC
CTGGGCTCCGGCTCTGCGCTGCAACTGCAGTCGACCGTCGGCACCGTCTTGACTGCACCGCTACGTCTGCCGGAA
CTGCTTCGGCTGGGTCGCAAAAGGGAGCCGAGACATATCCTGCATGGGTTCGAGGGCCTCGTCCGTAGCGGCGAG
CTGCTCATTGTGCTCGGACGGCCCGGCTCCGGGTGCAGTACCCTCCTTCGGACGTTGACGGGGGAGCTGCACGGG
CTGGACCTGGGATCCGACGCGAGCGTTCACTTCAATGGCATCCCGCTGAGGAAGATGCGGAGTGAGTTTCGGGGC
GAAATCATCTATAACCAGGAGGTGAGTTGCCTCTTCTTTTTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTC
TCGCCTCTTCTTCCTTGTCATTGTGTCCTTGTTCTTCCCCCTTTCCATCGCTCCTCTCACCGAGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail