Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4061
Gene name
Locationscaffold_318:362..1256
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14510 ABC_trans_N ABC-transporter N-terminal 3.3E-16 79 165
PF00005 ABC_tran ABC transporter 1.3E-05 196 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 107 257 1.0E-23
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 62 265 3.0E-23
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 107 257 7.0E-23
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 107 257 3.0E-21
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 107 257 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 107 257 1.0E-23
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 62 265 3.0E-23
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 107 257 7.0E-23
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 107 257 3.0E-21
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 107 257 1.0E-18
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 111 262 6.0E-18
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 108 262 8.0E-18
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 111 262 4.0E-17
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 111 262 2.0E-16
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 111 262 2.0E-16
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 116 257 3.0E-15
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 106 257 2.0E-14
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 117 262 3.0E-14
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 115 257 1.0E-12
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 106 257 3.0E-12
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 124 257 2.0E-11
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 124 257 2.0E-11
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 124 257 4.0E-11
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 148 257 3.0E-10
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 124 280 1.0E-09
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 108 257 4.0E-09
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 124 257 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 258 280 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4061
MSNASDQGDERPTAADEIDEDEAEPAAKDFAKDARQGRNLSMVTTRLGEIRSSPGSSLPSPSSACSSSSSMLGED
ERTELVRIATALSRNVASSGSRQGSLLYPVQYEPALDPAHDNFDLSAWLRRFIEQLQEQGITYRRTGVAFRHLDV
LGSGSALQLQSTVGTVLTAPLRLPELLRLGRKREPRHILHGFEGLVRSGELLIVLGRPGSGCSTLLRTLTGELHG
LDLGSDASVHFNGIPLRKMRSEFRGEIIYNQEVSCLFFFILLLLLLLLLFSPLLPCHCVLVLPPFHRSSHRV
Coding >Ophio5|4061
ATGTCGAATGCCTCGGACCAAGGAGACGAGCGGCCGACAGCGGCCGACGAAATCGACGAAGATGAGGCTGAACCG
GCGGCAAAGGACTTCGCCAAGGACGCGCGGCAGGGGAGAAACCTGTCGATGGTGACGACGCGTTTGGGAGAGATA
CGGTCCAGTCCAGGCAGCTCGCTGCCGTCTCCCTCTTCGGCTTGCTCTAGCAGCAGCTCGATGCTGGGAGAGGAC
GAAAGGACGGAGCTGGTGCGTATCGCCACGGCTCTTTCGCGCAACGTCGCCTCGTCTGGTAGCAGGCAGGGCTCG
TTGCTCTACCCGGTTCAGTACGAGCCGGCTCTGGACCCGGCTCACGACAACTTTGACCTCTCGGCTTGGCTGCGG
CGCTTCATCGAGCAGCTCCAGGAGCAGGGCATCACCTACCGACGCACCGGAGTCGCCTTTCGCCATCTCGACGTC
CTGGGCTCCGGCTCTGCGCTGCAACTGCAGTCGACCGTCGGCACCGTCTTGACTGCACCGCTACGTCTGCCGGAA
CTGCTTCGGCTGGGTCGCAAAAGGGAGCCGAGACATATCCTGCATGGGTTCGAGGGCCTCGTCCGTAGCGGCGAG
CTGCTCATTGTGCTCGGACGGCCCGGCTCCGGGTGCAGTACCCTCCTTCGGACGTTGACGGGGGAGCTGCACGGG
CTGGACCTGGGATCCGACGCGAGCGTTCACTTCAATGGCATCCCGCTGAGGAAGATGCGGAGTGAGTTTCGGGGC
GAAATCATCTATAACCAGGAGGTGAGTTGCCTCTTCTTTTTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTC
TCGCCTCTTCTTCCTTGTCATTGTGTCCTTGTTCTTCCCCCTTTCCATCGCTCCTCTCACCGAGTC
Transcript >Ophio5|4061
ATGTCGAATGCCTCGGACCAAGGAGACGAGCGGCCGACAGCGGCCGACGAAATCGACGAAGATGAGGCTGAACCG
GCGGCAAAGGACTTCGCCAAGGACGCGCGGCAGGGGAGAAACCTGTCGATGGTGACGACGCGTTTGGGAGAGATA
CGGTCCAGTCCAGGCAGCTCGCTGCCGTCTCCCTCTTCGGCTTGCTCTAGCAGCAGCTCGATGCTGGGAGAGGAC
GAAAGGACGGAGCTGGTGCGTATCGCCACGGCTCTTTCGCGCAACGTCGCCTCGTCTGGTAGCAGGCAGGGCTCG
TTGCTCTACCCGGTTCAGTACGAGCCGGCTCTGGACCCGGCTCACGACAACTTTGACCTCTCGGCTTGGCTGCGG
CGCTTCATCGAGCAGCTCCAGGAGCAGGGCATCACCTACCGACGCACCGGAGTCGCCTTTCGCCATCTCGACGTC
CTGGGCTCCGGCTCTGCGCTGCAACTGCAGTCGACCGTCGGCACCGTCTTGACTGCACCGCTACGTCTGCCGGAA
CTGCTTCGGCTGGGTCGCAAAAGGGAGCCGAGACATATCCTGCATGGGTTCGAGGGCCTCGTCCGTAGCGGCGAG
CTGCTCATTGTGCTCGGACGGCCCGGCTCCGGGTGCAGTACCCTCCTTCGGACGTTGACGGGGGAGCTGCACGGG
CTGGACCTGGGATCCGACGCGAGCGTTCACTTCAATGGCATCCCGCTGAGGAAGATGCGGAGTGAGTTTCGGGGC
GAAATCATCTATAACCAGGAGGTGAGTTGCCTCTTCTTTTTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTC
TCGCCTCTTCTTCCTTGTCATTGTGTCCTTGTTCTTCCCCCTTTCCATCGCTCCTCTCACCGAGTCTAA
Gene >Ophio5|4061
ATGTCGAATGCCTCGGACCAAGGAGACGAGCGGCCGACAGCGGCCGACGAAATCGACGAAGATGAGGCTGAACCG
GCGGCAAAGGACTTCGCCAAGGACGCGCGGCAGGGGAGAAACCTGTCGATGGTGACGACGCGTTTGGGAGAGATA
CGGTCCAGTCCAGGCAGCTCGCTGCCGTCTCCCTCTTCGGCTTGCTCTAGCAGCAGCTCGATGCTGGGAGAGGAC
GAAAGGACGGAGCTGGTGCGTATCGCCACGGCTCTTTCGCGCAACGTCGCCTCGTCTGGTAGCAGGCAGGGCTCG
TTGCTCTACCCGGTTCAGTACGAGCCGGCTCTGGACCCGGCTCACGACAACTTTGACCTCTCGGCTTGGCTGCGG
CGCTTCATCGAGCAGCTCCAGGAGCAGGGCATCACCTACCGACGCACCGGAGTCGCCTTTCGCCATCTCGACGTC
CTGGGCTCCGGCTCTGCGCTGCAACTGCAGTCGACCGTCGGCACCGTCTTGACTGCACCGCTACGTCTGCCGGAA
CTGCTTCGGCTGGGTCGCAAAAGGGAGCCGAGACATATCCTGCATGGGTTCGAGGGCCTCGTCCGTAGCGGCGAG
CTGCTCATTGTGCTCGGACGGCCCGGCTCCGGGTGCAGTACCCTCCTTCGGACGTTGACGGGGGAGCTGCACGGG
CTGGACCTGGGATCCGACGCGAGCGTTCACTTCAATGGCATCCCGCTGAGGAAGATGCGGAGTGAGTTTCGGGGC
GAAATCATCTATAACCAGGAGGTGAGTTGCCTCTTCTTTTTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTC
TCGCCTCTTCTTCCTTGTCATTGTGTCCTTGTTCTTCCCCCTTTCCATCGCTCCTCTCACCGAGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail