Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|406
Gene name
Locationscaffold_11:8898..10869
Strand+
Gene length (bp)1971
Transcript length (bp)1818
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10307 HAD_SAK_1 HAD domain family 1 in Swiss Army Knife RNA repair proteins 6.0E-71 85 288

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USS8|YNB2_SCHPO Uncharacterized protein C4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4.02c PE=1 SV=2 51 451 4.0E-44
sp|Q03508|YM8F_YEAST Uncharacterized protein YMR265C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR265C PE=4 SV=1 70 317 5.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|406
MARAVSKRLTSAILFFLQCMLAPIRLRPGLTASAMASTYQSASKGPHYFSTTSLGRWSVLNKQLPASENIKTLHV
YDFDNTLFKTPTPNPFLWNVTTISKLSSQYSFLNGGWWHDSRFLAATGEGVEKEQPRAWEGWWNETIVELVRMSM
QQSDALCILLTGRAENTFADLIKTMIASKGLEFDIVGLKPSASPANETFRSTMHFKKLFLTSLVETYRDATKIQI
FEDRPKHAAMFRDFFTEFNRRQTHSPTRGPLAADVVQVLDTCVRLDPVTEVAQVQHMLNQHNETLPRLGQTSSGA
RLRIKKTVLSTSYVIGTDDAKKIVGLAQIPAEVSNQDLKHYGSNIVISVRDCPPNVLEKVGGLGAKMLWEVTGIG
SLNDNLWAARLRPVPATAVYHTDETVPLVVLAVRNGARPSEASRITNWKPMPSDETFVFETTVGEKVILRVEAEN
PDEDEAYNNSASRPPKRKHMADDEWSPQHHRSSNHNYAGRNESRAFHSNARGRGAGSHRGGGGGSNRGNRGGGRG
ARGSRGGRGGYHGYRSLDDVDSRADHGGLGSKVDYDDAYRPPPSMPANRGRGLPPPPGRGGIQLPPRPVASDPDL
RRQYC
Coding >Ophio5|406
ATGGCAAGAGCCGTTTCAAAACGCCTCACCTCGGCCATCCTTTTTTTTCTCCAGTGCATGCTCGCGCCCATCCGC
CTTCGCCCAGGCCTCACCGCGAGCGCCATGGCCTCGACATACCAGAGCGCCTCCAAGGGCCCCCATTACTTCAGC
ACCACCTCCCTCGGCCGCTGGTCCGTCCTGAACAAGCAGCTTCCCGCCTCGGAAAATATCAAGACGCTGCACGTC
TACGACTTTGACAATACACTGTTCAAGACACCGACACCCAACCCTTTCCTCTGGAATGTCACGACGATCAGCAAG
CTTTCAAGCCAGTACTCCTTCCTGAATGGCGGCTGGTGGCATGACAGTCGTTTCCTTGCCGCCACCGGCGAAGGC
GTCGAAAAGGAGCAGCCGCGTGCTTGGGAAGGCTGGTGGAACGAGACCATCGTCGAGCTTGTCCGCATGTCGATG
CAGCAGTCCGACGCGCTGTGCATCCTACTGACGGGCCGAGCCGAAAACACCTTTGCCGACCTCATCAAGACTATG
ATTGCCAGCAAGGGCCTCGAATTCGACATCGTCGGCCTCAAGCCCTCGGCATCTCCCGCCAACGAGACGTTCCGC
AGCACTATGCACTTTAAGAAGCTCTTCCTCACCAGTCTCGTCGAGACTTATCGTGACGCCACCAAGATCCAGATC
TTCGAGGACCGTCCCAAACACGCGGCCATGTTTCGTGACTTCTTCACCGAATTCAACCGCCGCCAGACGCATTCT
CCCACGCGCGGGCCCTTGGCCGCTGACGTGGTCCAGGTTCTGGACACGTGCGTGCGCCTTGACCCGGTCACCGAG
GTGGCCCAGGTCCAGCACATGCTCAACCAGCACAACGAAACCCTGCCGAGGCTGGGCCAGACGTCGTCCGGCGCG
CGCCTCAGGATAAAGAAGACGGTCCTGTCGACCAGCTACGTCATCGGCACTGACGACGCCAAGAAGATTGTCGGC
CTCGCTCAGATCCCCGCCGAGGTCTCCAACCAGGACCTCAAGCACTACGGCAGCAACATCGTCATCTCCGTTCGC
GACTGTCCTCCCAACGTGCTGGAAAAGGTCGGTGGTCTCGGCGCCAAGATGCTCTGGGAGGTCACCGGCATCGGC
TCTCTCAACGACAATCTGTGGGCCGCTCGCCTGCGTCCCGTCCCGGCGACGGCCGTTTACCATACCGACGAAACC
GTGCCACTCGTCGTGCTGGCGGTGAGGAACGGAGCCAGGCCGTCTGAAGCCTCCCGCATCACCAACTGGAAGCCA
ATGCCTTCAGACGAGACCTTCGTCTTCGAGACAACCGTCGGCGAAAAGGTCATCCTTCGCGTCGAGGCCGAGAAC
CCGGACGAAGACGAAGCCTACAATAACTCCGCCTCCCGTCCGCCCAAGCGCAAGCACATGGCCGACGACGAATGG
TCTCCGCAACACCACCGCAGCAGCAATCATAACTACGCCGGCCGCAACGAGTCGAGAGCCTTCCACTCCAACGCC
CGCGGCCGCGGCGCTGGCTCCCATCGCGGCGGCGGCGGCGGTTCCAACCGCGGAAACCGTGGCGGCGGAAGAGGA
GCTAGAGGCTCCCGAGGCGGCCGCGGCGGCTACCACGGCTACCGCTCCCTCGACGACGTCGACTCCAGGGCTGAC
CACGGCGGACTCGGTTCAAAGGTTGATTATGACGACGCCTACCGGCCGCCTCCGTCCATGCCCGCGAATCGGGGC
CGCGGTCTGCCGCCCCCGCCCGGTCGAGGGGGCATACAGCTTCCTCCCCGGCCCGTGGCTAGCGATCCCGACTTG
CGTAGACAGTATTGC
Transcript >Ophio5|406
ATGGCAAGAGCCGTTTCAAAACGCCTCACCTCGGCCATCCTTTTTTTTCTCCAGTGCATGCTCGCGCCCATCCGC
CTTCGCCCAGGCCTCACCGCGAGCGCCATGGCCTCGACATACCAGAGCGCCTCCAAGGGCCCCCATTACTTCAGC
ACCACCTCCCTCGGCCGCTGGTCCGTCCTGAACAAGCAGCTTCCCGCCTCGGAAAATATCAAGACGCTGCACGTC
TACGACTTTGACAATACACTGTTCAAGACACCGACACCCAACCCTTTCCTCTGGAATGTCACGACGATCAGCAAG
CTTTCAAGCCAGTACTCCTTCCTGAATGGCGGCTGGTGGCATGACAGTCGTTTCCTTGCCGCCACCGGCGAAGGC
GTCGAAAAGGAGCAGCCGCGTGCTTGGGAAGGCTGGTGGAACGAGACCATCGTCGAGCTTGTCCGCATGTCGATG
CAGCAGTCCGACGCGCTGTGCATCCTACTGACGGGCCGAGCCGAAAACACCTTTGCCGACCTCATCAAGACTATG
ATTGCCAGCAAGGGCCTCGAATTCGACATCGTCGGCCTCAAGCCCTCGGCATCTCCCGCCAACGAGACGTTCCGC
AGCACTATGCACTTTAAGAAGCTCTTCCTCACCAGTCTCGTCGAGACTTATCGTGACGCCACCAAGATCCAGATC
TTCGAGGACCGTCCCAAACACGCGGCCATGTTTCGTGACTTCTTCACCGAATTCAACCGCCGCCAGACGCATTCT
CCCACGCGCGGGCCCTTGGCCGCTGACGTGGTCCAGGTTCTGGACACGTGCGTGCGCCTTGACCCGGTCACCGAG
GTGGCCCAGGTCCAGCACATGCTCAACCAGCACAACGAAACCCTGCCGAGGCTGGGCCAGACGTCGTCCGGCGCG
CGCCTCAGGATAAAGAAGACGGTCCTGTCGACCAGCTACGTCATCGGCACTGACGACGCCAAGAAGATTGTCGGC
CTCGCTCAGATCCCCGCCGAGGTCTCCAACCAGGACCTCAAGCACTACGGCAGCAACATCGTCATCTCCGTTCGC
GACTGTCCTCCCAACGTGCTGGAAAAGGTCGGTGGTCTCGGCGCCAAGATGCTCTGGGAGGTCACCGGCATCGGC
TCTCTCAACGACAATCTGTGGGCCGCTCGCCTGCGTCCCGTCCCGGCGACGGCCGTTTACCATACCGACGAAACC
GTGCCACTCGTCGTGCTGGCGGTGAGGAACGGAGCCAGGCCGTCTGAAGCCTCCCGCATCACCAACTGGAAGCCA
ATGCCTTCAGACGAGACCTTCGTCTTCGAGACAACCGTCGGCGAAAAGGTCATCCTTCGCGTCGAGGCCGAGAAC
CCGGACGAAGACGAAGCCTACAATAACTCCGCCTCCCGTCCGCCCAAGCGCAAGCACATGGCCGACGACGAATGG
TCTCCGCAACACCACCGCAGCAGCAATCATAACTACGCCGGCCGCAACGAGTCGAGAGCCTTCCACTCCAACGCC
CGCGGCCGCGGCGCTGGCTCCCATCGCGGCGGCGGCGGCGGTTCCAACCGCGGAAACCGTGGCGGCGGAAGAGGA
GCTAGAGGCTCCCGAGGCGGCCGCGGCGGCTACCACGGCTACCGCTCCCTCGACGACGTCGACTCCAGGGCTGAC
CACGGCGGACTCGGTTCAAAGGTTGATTATGACGACGCCTACCGGCCGCCTCCGTCCATGCCCGCGAATCGGGGC
CGCGGTCTGCCGCCCCCGCCCGGTCGAGGGGGCATACAGCTTCCTCCCCGGCCCGTGGCTAGCGATCCCGACTTG
CGTAGACAGTATTGCTAG
Gene >Ophio5|406
ATGGCAAGAGCCGTTTCAAAACGCCTCACCTCGGCCATCCTTTTTTTTCTCCAGTGCATGCTCGCGCCCATCCGC
CTTCGCCCAGGCCTCACCGCGAGCGCCATGGCCTCGACATACCAGAGCGCCTCCAAGGGCCCCCATTACTTCAGC
ACCACCTCCCTCGGCCGCTGGTCCGTCCTGAACAAGCAGCTTCCCGGTGCGTCGTCGTCATCCAGAGAGAGGAAG
ACAGAGAGAGCGAGAGATAGAGAGAAAGAGGGAGCCGCTGACGGGCGACTCGCAGCCTCGGAAAATATCAAGACG
CTGCACGTCTACGACTTTGACAATACACGTGCCGTTCCCCTTTTCCCTCTCTCCCCCAGCTGCTGACGGCCAACT
CATCCCCTATCCGTCACTGCAGTGTTCAAGACACCGACACCCAACCCTTTCCTCTGGAATGTCACGACGATCAGC
AAGCTTTCAAGCCAGTACTCCTTCCTGAATGGCGGCTGGTGGCATGACAGTCGTTTCCTTGCCGCCACCGGCGAA
GGCGTCGAAAAGGAGCAGCCGCGTGCTTGGGAAGGCTGGTGGAACGAGACCATCGTCGAGCTTGTCCGCATGTCG
ATGCAGCAGTCCGACGCGCTGTGCATCCTACTGACGGGCCGAGCCGAAAACACCTTTGCCGACCTCATCAAGACT
ATGATTGCCAGCAAGGGCCTCGAATTCGACATCGTCGGCCTCAAGCCCTCGGCATCTCCCGCCAACGAGACGTTC
CGCAGCACTATGCACTTTAAGAAGCTCTTCCTCACCAGTCTCGTCGAGACTTATCGTGACGCCACCAAGATCCAG
ATCTTCGAGGACCGTCCCAAACACGCGGCCATGTTTCGTGACTTCTTCACCGAATTCAACCGCCGCCAGACGCAT
TCTCCCACGCGCGGGCCCTTGGCCGCTGACGTGGTCCAGGTTCTGGACACGTGCGTGCGCCTTGACCCGGTCACC
GAGGTGGCCCAGGTCCAGCACATGCTCAACCAGCACAACGAAACCCTGCCGAGGCTGGGCCAGACGTCGTCCGGC
GCGCGCCTCAGGATAAAGAAGACGGTCCTGTCGACCAGCTACGTCATCGGCACTGACGACGCCAAGAAGATTGTC
GGCCTCGCTCAGATCCCCGCCGAGGTCTCCAACCAGGACCTCAAGCACTACGGCAGCAACATCGTCATCTCCGTT
CGCGACTGTCCTCCCAACGTGCTGGAAAAGGTCGGTGGTCTCGGCGCCAAGATGCTCTGGGAGGTCACCGGCATC
GGCTCTCTCAACGACAATCTGTGGGCCGCTCGCCTGCGTCCCGTCCCGGCGACGGCCGTTTACCATACCGACGAA
ACCGTGCCACTCGTCGTGCTGGCGGTGAGGAACGGAGCCAGGCCGTCTGAAGCCTCCCGCATCACCAACTGGAAG
CCAATGCCTTCAGACGAGACCTTCGTCTTCGAGACAACCGTCGGCGAAAAGGTCATCCTTCGCGTCGAGGCCGAG
AACCCGGACGAAGACGAAGCCTACAATAACTCCGCCTCCCGTCCGCCCAAGCGCAAGCACATGGCCGACGACGAA
TGGTCTCCGCAACACCACCGCAGCAGCAATCATAACTACGCCGGCCGCAACGAGTCGAGAGCCTTCCACTCCAAC
GCCCGCGGCCGCGGCGCTGGCTCCCATCGCGGCGGCGGCGGCGGTTCCAACCGCGGAAACCGTGGCGGCGGAAGA
GGAGCTAGAGGCTCCCGAGGCGGCCGCGGCGGCTACCACGGCTACCGCTCCCTCGACGACGTCGACTCCAGGGCT
GACCACGGCGGACTCGGTTCAAAGGTTGATTATGACGACGCCTACCGGCCGCCTCCGTCCATGCCCGCGAATCGG
GGCCGCGGTCTGCCGCCCCCGCCCGGTCGAGGGGGCATACAGCTTCCTCCCCGGCCCGTGGCTAGCGATCCCGAC
TTGCGTAGACAGTATTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail