Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4058
Gene name
Locationscaffold_317:17603..18485
Strand+
Gene length (bp)882
Transcript length (bp)690
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01991 vATP-synt_E ATP synthase (E/31 kDa) subunit 1.1E-66 21 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01278|VATE_NEUCR V-type proton ATPase subunit E OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-4 PE=2 SV=1 1 229 2.0E-95
sp|O94072|VATE_CANAX V-type proton ATPase subunit E OS=Candida albicans GN=VMA4 PE=3 SV=1 5 229 1.0E-65
sp|Q4R761|VATE1_MACFA V-type proton ATPase subunit E 1 OS=Macaca fascicularis GN=ATP6V1E1 PE=2 SV=1 5 229 1.0E-60
sp|P36543|VATE1_HUMAN V-type proton ATPase subunit E 1 OS=Homo sapiens GN=ATP6V1E1 PE=1 SV=1 5 229 1.0E-60
sp|P11019|VATE1_BOVIN V-type proton ATPase subunit E 1 OS=Bos taurus GN=ATP6V1E1 PE=2 SV=1 5 229 7.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01278|VATE_NEUCR V-type proton ATPase subunit E OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-4 PE=2 SV=1 1 229 2.0E-95
sp|O94072|VATE_CANAX V-type proton ATPase subunit E OS=Candida albicans GN=VMA4 PE=3 SV=1 5 229 1.0E-65
sp|Q4R761|VATE1_MACFA V-type proton ATPase subunit E 1 OS=Macaca fascicularis GN=ATP6V1E1 PE=2 SV=1 5 229 1.0E-60
sp|P36543|VATE1_HUMAN V-type proton ATPase subunit E 1 OS=Homo sapiens GN=ATP6V1E1 PE=1 SV=1 5 229 1.0E-60
sp|P11019|VATE1_BOVIN V-type proton ATPase subunit E 1 OS=Bos taurus GN=ATP6V1E1 PE=2 SV=1 5 229 7.0E-60
sp|P50518|VATE1_MOUSE V-type proton ATPase subunit E 1 OS=Mus musculus GN=Atp6v1e1 PE=1 SV=2 5 229 1.0E-59
sp|Q6PCU2|VATE1_RAT V-type proton ATPase subunit E 1 OS=Rattus norvegicus GN=Atp6v1e1 PE=1 SV=1 5 229 2.0E-59
sp|P22203|VATE_YEAST V-type proton ATPase subunit E OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA4 PE=1 SV=4 5 229 8.0E-57
sp|P31402|VATE_MANSE V-type proton ATPase subunit E OS=Manduca sexta GN=VHA26 PE=2 SV=1 5 229 6.0E-56
sp|P54611|VATE_DROME V-type proton ATPase subunit E OS=Drosophila melanogaster GN=Vha26 PE=2 SV=1 5 229 5.0E-53
sp|O13687|VATE_SCHPO V-type proton ATPase subunit E OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma4 PE=3 SV=1 5 227 3.0E-51
sp|Q9U1G5|VATE_HETSC V-type proton ATPase subunit E OS=Heterodera schachtii PE=2 SV=1 5 229 5.0E-50
sp|O00780|VATE_DICDI V-type proton ATPase subunit E OS=Dictyostelium discoideum GN=vatE PE=1 SV=1 6 229 1.0E-45
sp|Q96A05|VATE2_HUMAN V-type proton ATPase subunit E 2 OS=Homo sapiens GN=ATP6V1E2 PE=1 SV=1 5 228 2.0E-42
sp|Q32LB7|VATE2_BOVIN V-type proton ATPase subunit E 2 OS=Bos taurus GN=ATP6V1E2 PE=2 SV=1 5 228 3.0E-42
sp|Q9D593|VATE2_MOUSE V-type proton ATPase subunit E 2 OS=Mus musculus GN=Atp6v1e2 PE=1 SV=1 5 228 3.0E-37
sp|Q9MB46|VATE_CITUN V-type proton ATPase subunit E OS=Citrus unshiu GN=VATE PE=2 SV=1 6 221 9.0E-37
sp|Q9SWE7|VATE_CITLI V-type proton ATPase subunit E OS=Citrus limon GN=VATE PE=2 SV=1 6 221 2.0E-35
sp|O23948|VATE_GOSHI V-type proton ATPase subunit E OS=Gossypium hirsutum GN=VATE PE=2 SV=1 6 221 4.0E-35
sp|P0CAN7|VATE3_ARATH V-type proton ATPase subunit E3 OS=Arabidopsis thaliana GN=VHA-E3 PE=2 SV=1 6 221 4.0E-35
sp|Q39258|VATE1_ARATH V-type proton ATPase subunit E1 OS=Arabidopsis thaliana GN=VHA-E1 PE=1 SV=2 6 221 8.0E-35
sp|Q40272|VATE_MESCR V-type proton ATPase subunit E OS=Mesembryanthemum crystallinum GN=VATE PE=2 SV=1 6 220 3.0E-32
sp|Q9C9Z8|VATE2_ARATH V-type proton ATPase subunit E2 OS=Arabidopsis thaliana GN=VHA-E2 PE=2 SV=1 6 220 1.0E-31
sp|Q41396|VATE_SPIOL V-type proton ATPase subunit E OS=Spinacia oleracea GN=VATE PE=2 SV=1 6 220 2.0E-31
sp|O06501|VATE_DESSY V-type ATP synthase subunit E OS=Desulfurococcus sp. (strain SY) GN=atpE PE=3 SV=1 66 220 3.0E-10
sp|Q5JDS0|VATE_THEKO V-type ATP synthase subunit E OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=atpE PE=3 SV=1 66 220 7.0E-10
sp|C6A5F1|VATE_THESM V-type proton ATPase subunit E OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=atpE PE=3 SV=1 1 220 3.0E-09
sp|C5A333|VATE_THEGJ V-type proton ATPase subunit E OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=atpE PE=3 SV=1 58 220 1.0E-07
sp|Q3J9F2|VATE_NITOC V-type ATP synthase subunit E OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpE PE=3 SV=1 68 219 2.0E-07
sp|O57724|VATE_PYRHO V-type ATP synthase subunit E OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=atpE PE=1 SV=1 1 220 4.0E-07
sp|A5UKB5|VATE_METS3 V-type ATP synthase subunit E OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=atpE PE=3 SV=1 17 219 6.0E-07
sp|Q2NF84|VATE_METST V-type ATP synthase subunit E OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=atpE PE=3 SV=1 17 219 2.0E-06
sp|Q8U4A9|VATE_PYRFU V-type ATP synthase subunit E OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=atpE PE=3 SV=1 66 220 2.0E-06
sp|B6YV11|VATE_THEON V-type proton ATPase subunit E OS=Thermococcus onnurineus (strain NA1) GN=atpE PE=3 SV=1 66 220 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain Yes
GO:1902600 proton transmembrane transport Yes
GO:0022853 active ion transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0032991 protein-containing complex No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0009987 cellular process No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0098796 membrane protein complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4058
MSQHALSDQQVDNELRKMTAFIKQEAMEKAREIEIKANEEFEIEKSKLVRQETDSIDSQYDKKFKQATMSQQITR
STVANKTRLKVLGARQELLDDIFESAEKQLADGTKDKPKYQKILVGLILEGLYALNEKQVVLRARKKDHDMVKKA
ADEASKTYKKEIGSDVDVKISDESPLPENSAGGVIIVGGGGKIDINNTFETRLDLLKTSAAPAVRQSLFGKNPNR
KFYD
Coding >Ophio5|4058
ATGTCACAACACGCCCTTTCCGACCAACAGGTCGACAATGAGCTCCGCAAGATGACAGCCTTCATCAAGCAAGAA
GCCATGGAGAAAGCGCGCGAGATCGAAATCAAAGCCAACGAAGAGTTCGAAATCGAAAAATCCAAGCTCGTCCGT
CAGGAGACCGACTCCATCGATAGCCAGTACGACAAAAAGTTCAAGCAAGCCACCATGTCTCAGCAAATCACCCGC
TCCACCGTCGCCAATAAGACGCGCCTCAAGGTTCTCGGCGCCCGACAGGAGCTTCTCGACGACATCTTCGAGTCG
GCTGAGAAGCAGCTCGCTGATGGTACCAAGGATAAGCCCAAGTATCAAAAGATTCTCGTCGGCCTTATCCTCGAG
GGCCTCTACGCCCTCAACGAGAAGCAAGTGGTGCTGCGCGCTCGCAAGAAGGATCACGATATGGTTAAGAAGGCG
GCTGATGAGGCGTCCAAGACGTACAAGAAGGAGATTGGCTCTGATGTCGATGTTAAGATCAGCGACGAGAGCCCC
CTTCCTGAAAACTCCGCCGGCGGAGTCATCATCGTCGGTGGAGGCGGCAAGATCGACATCAACAACACCTTCGAG
ACGAGACTGGACCTTCTCAAGACATCGGCTGCCCCCGCCGTGCGCCAGTCTCTATTTGGCAAGAACCCGAACCGC
AAGTTTTACGAC
Transcript >Ophio5|4058
ATGTCACAACACGCCCTTTCCGACCAACAGGTCGACAATGAGCTCCGCAAGATGACAGCCTTCATCAAGCAAGAA
GCCATGGAGAAAGCGCGCGAGATCGAAATCAAAGCCAACGAAGAGTTCGAAATCGAAAAATCCAAGCTCGTCCGT
CAGGAGACCGACTCCATCGATAGCCAGTACGACAAAAAGTTCAAGCAAGCCACCATGTCTCAGCAAATCACCCGC
TCCACCGTCGCCAATAAGACGCGCCTCAAGGTTCTCGGCGCCCGACAGGAGCTTCTCGACGACATCTTCGAGTCG
GCTGAGAAGCAGCTCGCTGATGGTACCAAGGATAAGCCCAAGTATCAAAAGATTCTCGTCGGCCTTATCCTCGAG
GGCCTCTACGCCCTCAACGAGAAGCAAGTGGTGCTGCGCGCTCGCAAGAAGGATCACGATATGGTTAAGAAGGCG
GCTGATGAGGCGTCCAAGACGTACAAGAAGGAGATTGGCTCTGATGTCGATGTTAAGATCAGCGACGAGAGCCCC
CTTCCTGAAAACTCCGCCGGCGGAGTCATCATCGTCGGTGGAGGCGGCAAGATCGACATCAACAACACCTTCGAG
ACGAGACTGGACCTTCTCAAGACATCGGCTGCCCCCGCCGTGCGCCAGTCTCTATTTGGCAAGAACCCGAACCGC
AAGTTTTACGACTAG
Gene >Ophio5|4058
ATGTCACAACACGCCCTTTCCGACCAACAGGTACGTCCCATTTCCCAACGATAACCGACGAGCCTTCACCTTTTT
CACCCTCTTCATACCCGCGGACATAGCCCACCGACTCCTCCGAAGACGCCGGACAATGGCTAACCGTCGGCGCCA
GGTCGACAATGAGCTCCGCAAGATGACAGCCTTCATCAAGCAAGAAGCCATGGAGAAAGCGCGCGAGATCGAAAT
CAAAGCCAACGAAGAGTTCGAAATCGAAAAATCCAAGCTCGTCCGTCAGGAGACCGACTCCATCGATAGCCAGTA
CGACAAAAAGTTCAAGCAAGCCACCATGTCTCAGCAAATCACCCGCTCCACCGTCGCCAATAAGACGCGCCTCAA
GGTTCTCGGCGCCCGACAGGAGCTTCTCGACGACATCTTCGAGTCGGCTGAGAAGCAGCTCGCTGATGGTACCAA
GGATAAGCCCAAGTATCAAAAGATTCTCGTCGGCCTTATCCTCGAGGGCCTCTACGCCCTCAACGAGAAGCAAGT
GGTGCTGCGCGCTCGCAAGAAGGATCACGATATGGTTAAGAAGGCGGCTGATGAGGCGTCCAAGACGTACAAGAA
GGAGATTGGCTCTGATGTCGATGTTAAGATCAGCGACGAGAGCCCCCTTCCTGAAAACTCGTCAGTCTTCCCCCT
TGCCCCCTTGCTCTTCCCCTTTCTCTGCGGCTCGAGTCCTAAAATATCGCTCACAGCGCCGGCGGAGTCATCATC
GTCGGTGGAGGCGGCAAGATCGACATCAACAACACCTTCGAGACGAGACTGGACCTTCTCAAGACATCGGCTGCC
CCCGCCGTGCGCCAGTCTCTATTTGGCAAGAACCCGAACCGCAAGTTTTACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail