Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4057
Gene name
Locationscaffold_317:15124..16743
Strand-
Gene length (bp)1619
Transcript length (bp)1560
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05653 Mg_trans_NIPA Magnesium transporter NIPA 2.1E-15 16 308

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8RWF4|NIPA8_ARATH Probable magnesium transporter NIPA8 OS=Arabidopsis thaliana GN=At3g26670 PE=2 SV=1 51 305 7.0E-14
sp|Q9LIR9|NIPA1_ARATH Probable magnesium transporter NIPA1 OS=Arabidopsis thaliana GN=At3g23870 PE=2 SV=1 59 308 3.0E-07
sp|B3LFA3|NIPA2_ARATH Probable magnesium transporter NIPA2 OS=Arabidopsis thaliana GN=At4g13800 PE=2 SV=1 59 308 3.0E-07

GO

GO Term Description Terminal node
GO:0015095 magnesium ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0015693 magnesium ion transport Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0005575 cellular_component No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 59 81 22
3 85 107 22
4 114 136 22
5 151 173 22
6 185 207 22
7 227 249 22
8 254 276 22
9 286 308 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4057
MAPLGGISPGGSIALGIVVGLMSTSVQSLGLTLQRKSHILEDEKYPHEVRRPPYRRRRWQLGMAMFIMANLLGST
VQISTLPLPVLSTLQAAGLVFNSICATLILSEPFTRWSLCGTVLVTSGAILIAIFGAIPSPAHDLEELMILMGRK
PFVAWMILQALFVVGIAVFIEVVNKSSNLSLNSRFRLVRGILYGVISGDLSAHALLFAKSSVELIIKTIGGSNQF
AHWQSWMMVLALLALALSQLYYLHRGLKLVSTSVLYPLVFCVYNIIAILDGLIYFNQTSFISPLRACLITLGTVI
LLSGVLALSWRLSDEQHPPGVGQSTLAPGLGLVEDTEGEEESLLESESVVDDSTPTYETFPPDISGDTTAMTPAP
RNKTFRWAERAEIWGELHDRRDAGSPTGSRHRSSTMPGRTESTPLLLASSSRRAEASSAETVAEAGTSAESTPRR
LGRRRRRSTGFPGLVARRNVRKRSSSTSGSLRNMLTLGWWTGRGNRSSLGSWSRPTATRENSNQAEGQV
Coding >Ophio5|4057
ATGGCACCTCTGGGCGGCATCTCCCCCGGCGGGAGCATCGCTCTGGGCATCGTCGTCGGCCTCATGTCCACAAGC
GTGCAGAGCCTCGGTCTGACGCTGCAACGAAAGTCTCACATCCTAGAGGACGAAAAGTATCCGCACGAGGTGCGC
CGCCCGCCCTATCGCAGGCGGAGATGGCAGCTGGGCATGGCCATGTTTATCATGGCCAATCTGCTGGGCAGCACG
GTTCAAATATCCACCCTGCCCTTACCCGTGCTGTCGACCCTGCAGGCGGCCGGCCTCGTCTTTAACTCGATATGC
GCCACCCTCATCCTCAGCGAGCCATTTACGCGCTGGTCTCTCTGCGGCACAGTCCTCGTCACCTCCGGCGCCATC
CTCATCGCCATCTTTGGCGCCATTCCATCTCCCGCTCATGATCTGGAAGAGCTCATGATCCTCATGGGCAGGAAG
CCCTTTGTCGCCTGGATGATTCTCCAGGCCCTCTTCGTCGTCGGCATCGCCGTATTTATAGAAGTCGTCAACAAA
TCGTCCAACCTCTCGCTCAACTCTCGCTTCCGTCTGGTGCGCGGCATCCTTTATGGTGTCATCAGCGGCGACCTC
TCGGCGCACGCGCTCCTCTTCGCCAAGTCGTCCGTCGAGCTCATCATCAAGACCATCGGCGGCAGCAATCAGTTC
GCCCACTGGCAGTCCTGGATGATGGTACTGGCCCTCCTCGCTCTGGCTCTGAGCCAGCTCTACTACCTTCACCGC
GGCCTGAAACTCGTCTCTACGTCGGTTCTGTATCCGCTCGTGTTTTGCGTCTATAACATCATCGCCATCCTCGAC
GGCCTGATATACTTTAACCAGACCAGCTTCATCTCGCCTCTGCGCGCTTGTCTCATCACCCTCGGCACCGTCATC
CTACTGTCAGGCGTCCTGGCGCTGTCCTGGCGACTTAGTGACGAACAGCATCCGCCCGGCGTCGGCCAGTCCACC
CTGGCGCCCGGTCTGGGCCTTGTGGAAGACACCGAGGGCGAGGAGGAGTCGCTGCTGGAATCCGAGTCTGTGGTG
GACGACTCGACCCCGACGTATGAGACGTTTCCGCCGGACATCAGCGGCGACACGACAGCCATGACGCCGGCACCT
CGCAACAAGACGTTTCGCTGGGCTGAGCGCGCCGAGATCTGGGGCGAGCTGCATGACCGGCGAGACGCCGGCTCG
CCGACGGGCAGCAGACACCGGTCCAGCACGATGCCGGGCCGGACGGAGAGCACGCCGTTGCTGCTGGCGTCGTCT
TCGCGAAGAGCCGAGGCCAGCTCGGCCGAGACGGTTGCCGAGGCCGGAACCAGCGCCGAGTCGACACCCCGCAGG
CTCGGCCGACGGCGAAGGAGGAGCACCGGCTTTCCCGGCCTCGTGGCGCGGCGCAACGTGCGTAAGAGAAGCTCG
TCGACGTCCGGCTCGCTGCGCAACATGCTCACGCTCGGCTGGTGGACCGGTCGGGGCAACCGCTCATCTCTCGGC
AGCTGGTCACGGCCCACAGCGACACGGGAGAACAGCAATCAAGCTGAAGGCCAAGTG
Transcript >Ophio5|4057
ATGGCACCTCTGGGCGGCATCTCCCCCGGCGGGAGCATCGCTCTGGGCATCGTCGTCGGCCTCATGTCCACAAGC
GTGCAGAGCCTCGGTCTGACGCTGCAACGAAAGTCTCACATCCTAGAGGACGAAAAGTATCCGCACGAGGTGCGC
CGCCCGCCCTATCGCAGGCGGAGATGGCAGCTGGGCATGGCCATGTTTATCATGGCCAATCTGCTGGGCAGCACG
GTTCAAATATCCACCCTGCCCTTACCCGTGCTGTCGACCCTGCAGGCGGCCGGCCTCGTCTTTAACTCGATATGC
GCCACCCTCATCCTCAGCGAGCCATTTACGCGCTGGTCTCTCTGCGGCACAGTCCTCGTCACCTCCGGCGCCATC
CTCATCGCCATCTTTGGCGCCATTCCATCTCCCGCTCATGATCTGGAAGAGCTCATGATCCTCATGGGCAGGAAG
CCCTTTGTCGCCTGGATGATTCTCCAGGCCCTCTTCGTCGTCGGCATCGCCGTATTTATAGAAGTCGTCAACAAA
TCGTCCAACCTCTCGCTCAACTCTCGCTTCCGTCTGGTGCGCGGCATCCTTTATGGTGTCATCAGCGGCGACCTC
TCGGCGCACGCGCTCCTCTTCGCCAAGTCGTCCGTCGAGCTCATCATCAAGACCATCGGCGGCAGCAATCAGTTC
GCCCACTGGCAGTCCTGGATGATGGTACTGGCCCTCCTCGCTCTGGCTCTGAGCCAGCTCTACTACCTTCACCGC
GGCCTGAAACTCGTCTCTACGTCGGTTCTGTATCCGCTCGTGTTTTGCGTCTATAACATCATCGCCATCCTCGAC
GGCCTGATATACTTTAACCAGACCAGCTTCATCTCGCCTCTGCGCGCTTGTCTCATCACCCTCGGCACCGTCATC
CTACTGTCAGGCGTCCTGGCGCTGTCCTGGCGACTTAGTGACGAACAGCATCCGCCCGGCGTCGGCCAGTCCACC
CTGGCGCCCGGTCTGGGCCTTGTGGAAGACACCGAGGGCGAGGAGGAGTCGCTGCTGGAATCCGAGTCTGTGGTG
GACGACTCGACCCCGACGTATGAGACGTTTCCGCCGGACATCAGCGGCGACACGACAGCCATGACGCCGGCACCT
CGCAACAAGACGTTTCGCTGGGCTGAGCGCGCCGAGATCTGGGGCGAGCTGCATGACCGGCGAGACGCCGGCTCG
CCGACGGGCAGCAGACACCGGTCCAGCACGATGCCGGGCCGGACGGAGAGCACGCCGTTGCTGCTGGCGTCGTCT
TCGCGAAGAGCCGAGGCCAGCTCGGCCGAGACGGTTGCCGAGGCCGGAACCAGCGCCGAGTCGACACCCCGCAGG
CTCGGCCGACGGCGAAGGAGGAGCACCGGCTTTCCCGGCCTCGTGGCGCGGCGCAACGTGCGTAAGAGAAGCTCG
TCGACGTCCGGCTCGCTGCGCAACATGCTCACGCTCGGCTGGTGGACCGGTCGGGGCAACCGCTCATCTCTCGGC
AGCTGGTCACGGCCCACAGCGACACGGGAGAACAGCAATCAAGCTGAAGGCCAAGTGTAG
Gene >Ophio5|4057
ATGGCACCTCTGGGCGGCATCTCCCCCGGCGGGAGCATCGCTGTAAGGCTCTCTCACTCCACCGCTTGCTGCGCC
ATTGCGCTGACCAAGGCAATATATAGCTGGGCATCGTCGTCGGCCTCATGTCCACAAGCGTGCAGAGCCTCGGTC
TGACGCTGCAACGAAAGTCTCACATCCTAGAGGACGAAAAGTATCCGCACGAGGTGCGCCGCCCGCCCTATCGCA
GGCGGAGATGGCAGCTGGGCATGGCCATGTTTATCATGGCCAATCTGCTGGGCAGCACGGTTCAAATATCCACCC
TGCCCTTACCCGTGCTGTCGACCCTGCAGGCGGCCGGCCTCGTCTTTAACTCGATATGCGCCACCCTCATCCTCA
GCGAGCCATTTACGCGCTGGTCTCTCTGCGGCACAGTCCTCGTCACCTCCGGCGCCATCCTCATCGCCATCTTTG
GCGCCATTCCATCTCCCGCTCATGATCTGGAAGAGCTCATGATCCTCATGGGCAGGAAGCCCTTTGTCGCCTGGA
TGATTCTCCAGGCCCTCTTCGTCGTCGGCATCGCCGTATTTATAGAAGTCGTCAACAAATCGTCCAACCTCTCGC
TCAACTCTCGCTTCCGTCTGGTGCGCGGCATCCTTTATGGTGTCATCAGCGGCGACCTCTCGGCGCACGCGCTCC
TCTTCGCCAAGTCGTCCGTCGAGCTCATCATCAAGACCATCGGCGGCAGCAATCAGTTCGCCCACTGGCAGTCCT
GGATGATGGTACTGGCCCTCCTCGCTCTGGCTCTGAGCCAGCTCTACTACCTTCACCGCGGCCTGAAACTCGTCT
CTACGTCGGTTCTGTATCCGCTCGTGTTTTGCGTCTATAACATCATCGCCATCCTCGACGGCCTGATATACTTTA
ACCAGACCAGCTTCATCTCGCCTCTGCGCGCTTGTCTCATCACCCTCGGCACCGTCATCCTACTGTCAGGCGTCC
TGGCGCTGTCCTGGCGACTTAGTGACGAACAGCATCCGCCCGGCGTCGGCCAGTCCACCCTGGCGCCCGGTCTGG
GCCTTGTGGAAGACACCGAGGGCGAGGAGGAGTCGCTGCTGGAATCCGAGTCTGTGGTGGACGACTCGACCCCGA
CGTATGAGACGTTTCCGCCGGACATCAGCGGCGACACGACAGCCATGACGCCGGCACCTCGCAACAAGACGTTTC
GCTGGGCTGAGCGCGCCGAGATCTGGGGCGAGCTGCATGACCGGCGAGACGCCGGCTCGCCGACGGGCAGCAGAC
ACCGGTCCAGCACGATGCCGGGCCGGACGGAGAGCACGCCGTTGCTGCTGGCGTCGTCTTCGCGAAGAGCCGAGG
CCAGCTCGGCCGAGACGGTTGCCGAGGCCGGAACCAGCGCCGAGTCGACACCCCGCAGGCTCGGCCGACGGCGAA
GGAGGAGCACCGGCTTTCCCGGCCTCGTGGCGCGGCGCAACGTGCGTAAGAGAAGCTCGTCGACGTCCGGCTCGC
TGCGCAACATGCTCACGCTCGGCTGGTGGACCGGTCGGGGCAACCGCTCATCTCTCGGCAGCTGGTCACGGCCCA
CAGCGACACGGGAGAACAGCAATCAAGCTGAAGGCCAAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail