Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4045
Gene name
Locationscaffold_316:12338..14367
Strand+
Gene length (bp)2029
Transcript length (bp)1914
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05536 Neurochondrin Neurochondrin 2.8E-85 19 520

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74447|YCG2_SCHPO Uncharacterized protein C16C4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.02c PE=1 SV=1 305 568 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4045
MDKPQPAQKPSADPPPVDAASLANIQSLLQARDDTQRFVGLALLKSVLDNSQLLRQDEAVIKSLWESLSAKFLDR
LLRTGSNPANQHASDMLDLAVSVLHTFAALLPESSRADAKFTARIPGLVGTILCSSDETIGLTLQLLHTLVSLPQ
GARILVNCQDLSPLTENAPSHPLVLDILGFAWLNGMADAENRLVLSQKIDATLKSLSSSFTGTDAVIFLEFLGTF
LRQADPAVLPKDPKWLSKVCGYIHSLAMSRPTPEARSAYTNAAASLVQIYPNQAPKLLFTDDRSADKAPAYLLMN
LLLIDIRSSAPTLLGQLNARDSAATTRRLASAFDVVCIFVGFLARFLDGDCQDDLVMSPDSLLKIRKGISDTMSV
TIEYLRDRWDASVAGAMGLHPDARVGNAETATGSHRTLAWDSIANSADDDPLVLSAVRTLALWLREDENELLRKE
ATGLTDMFMDLYRGSAPGKLDFRSPILVALEALVELDKGRDLLLRHDGWQILCKDLTDILNDTSTTNDKDGTSRG
IEIVRVLVQVVEQESTGTAEAWMDLITTVAAWDVPVQERPLEAKEFQLAVLELCCALLLGASNGMRNRYRHSFKA
VAGIATRMRPLMACDGRLSGPMQDVLETLNGNVSKSD
Coding >Ophio5|4045
ATGGACAAGCCACAGCCGGCTCAAAAGCCCAGCGCTGATCCGCCACCCGTCGATGCCGCCAGCTTGGCCAACATC
CAGAGCCTCCTACAGGCACGCGACGACACGCAGAGATTCGTCGGTCTGGCTCTGCTCAAGTCTGTTCTCGACAAC
TCGCAGCTACTTCGCCAGGACGAAGCCGTCATCAAGTCGCTATGGGAGAGCCTGTCTGCCAAGTTCTTAGACAGG
CTGCTACGCACAGGGTCCAACCCGGCAAATCAACACGCAAGCGACATGCTGGACCTGGCCGTCTCCGTCTTGCAC
ACATTTGCTGCCCTACTGCCCGAGAGTTCGCGGGCAGATGCCAAGTTTACTGCCAGAATACCTGGCCTGGTCGGA
ACCATCCTGTGCAGTTCCGACGAGACTATCGGCCTCACCCTGCAGCTCCTTCATACACTTGTCAGCTTGCCTCAA
GGGGCTCGCATTCTCGTCAACTGCCAGGATCTGAGCCCCCTCACCGAGAATGCGCCATCGCATCCCCTCGTCCTA
GACATCCTGGGCTTTGCATGGCTCAATGGCATGGCGGACGCCGAGAATAGACTTGTGCTTTCACAAAAAATAGAC
GCAACCCTGAAAAGCCTCTCCTCCTCTTTCACCGGCACGGATGCCGTCATATTCCTTGAGTTTCTTGGAACTTTC
CTGCGACAGGCGGATCCTGCTGTATTGCCCAAAGACCCCAAGTGGCTCAGTAAAGTATGCGGTTACATTCACAGT
CTTGCCATGAGTCGACCGACTCCTGAAGCAAGGTCTGCCTACACGAATGCTGCCGCGTCTCTTGTCCAGATCTAT
CCAAATCAGGCCCCGAAGCTCCTATTCACGGATGATCGTAGCGCAGACAAAGCTCCCGCCTATCTTCTCATGAAT
CTCCTACTCATCGATATCCGCTCATCCGCGCCGACGCTTCTGGGCCAGCTCAACGCGCGAGACAGCGCTGCAACG
ACAAGACGATTGGCGTCGGCATTCGACGTCGTCTGCATCTTTGTGGGATTCCTGGCTCGATTTCTCGACGGTGAC
TGTCAAGATGACTTGGTCATGTCTCCGGACAGTCTCCTCAAGATTCGAAAGGGTATATCAGACACAATGTCGGTA
ACGATTGAGTATCTTCGAGATCGGTGGGATGCCTCGGTCGCCGGGGCCATGGGTTTGCATCCCGACGCCCGAGTT
GGCAACGCCGAGACGGCAACCGGCTCACACCGAACCTTGGCATGGGACTCGATTGCGAACTCGGCCGATGACGAT
CCGTTGGTACTGTCCGCTGTCCGCACGCTGGCGCTCTGGCTGAGGGAGGATGAAAACGAGCTGTTGCGCAAGGAG
GCGACGGGATTAACGGACATGTTTATGGATCTCTACCGGGGGAGCGCGCCGGGAAAGCTCGACTTCAGGTCGCCC
ATACTCGTTGCACTGGAGGCCTTGGTCGAACTGGATAAGGGGCGGGACCTCCTCCTCCGCCATGATGGCTGGCAG
ATCCTTTGCAAAGATCTGACTGACATACTCAACGACACATCAACCACCAACGACAAGGACGGGACCTCTCGCGGC
ATCGAAATCGTCCGTGTCCTCGTTCAGGTCGTGGAACAGGAGTCAACCGGTACGGCAGAGGCGTGGATGGATCTG
ATTACCACCGTTGCCGCCTGGGACGTACCCGTTCAGGAGCGGCCGCTCGAGGCGAAAGAGTTTCAACTTGCGGTG
TTGGAATTGTGTTGCGCGCTGCTGCTGGGGGCGAGCAACGGTATGCGAAACAGATATAGGCACTCGTTCAAAGCA
GTCGCGGGTATCGCAACGCGGATGAGGCCCTTGATGGCGTGTGATGGTCGCCTGAGCGGGCCGATGCAGGATGTC
CTGGAGACCTTGAACGGCAACGTCTCGAAGAGCGAC
Transcript >Ophio5|4045
ATGGACAAGCCACAGCCGGCTCAAAAGCCCAGCGCTGATCCGCCACCCGTCGATGCCGCCAGCTTGGCCAACATC
CAGAGCCTCCTACAGGCACGCGACGACACGCAGAGATTCGTCGGTCTGGCTCTGCTCAAGTCTGTTCTCGACAAC
TCGCAGCTACTTCGCCAGGACGAAGCCGTCATCAAGTCGCTATGGGAGAGCCTGTCTGCCAAGTTCTTAGACAGG
CTGCTACGCACAGGGTCCAACCCGGCAAATCAACACGCAAGCGACATGCTGGACCTGGCCGTCTCCGTCTTGCAC
ACATTTGCTGCCCTACTGCCCGAGAGTTCGCGGGCAGATGCCAAGTTTACTGCCAGAATACCTGGCCTGGTCGGA
ACCATCCTGTGCAGTTCCGACGAGACTATCGGCCTCACCCTGCAGCTCCTTCATACACTTGTCAGCTTGCCTCAA
GGGGCTCGCATTCTCGTCAACTGCCAGGATCTGAGCCCCCTCACCGAGAATGCGCCATCGCATCCCCTCGTCCTA
GACATCCTGGGCTTTGCATGGCTCAATGGCATGGCGGACGCCGAGAATAGACTTGTGCTTTCACAAAAAATAGAC
GCAACCCTGAAAAGCCTCTCCTCCTCTTTCACCGGCACGGATGCCGTCATATTCCTTGAGTTTCTTGGAACTTTC
CTGCGACAGGCGGATCCTGCTGTATTGCCCAAAGACCCCAAGTGGCTCAGTAAAGTATGCGGTTACATTCACAGT
CTTGCCATGAGTCGACCGACTCCTGAAGCAAGGTCTGCCTACACGAATGCTGCCGCGTCTCTTGTCCAGATCTAT
CCAAATCAGGCCCCGAAGCTCCTATTCACGGATGATCGTAGCGCAGACAAAGCTCCCGCCTATCTTCTCATGAAT
CTCCTACTCATCGATATCCGCTCATCCGCGCCGACGCTTCTGGGCCAGCTCAACGCGCGAGACAGCGCTGCAACG
ACAAGACGATTGGCGTCGGCATTCGACGTCGTCTGCATCTTTGTGGGATTCCTGGCTCGATTTCTCGACGGTGAC
TGTCAAGATGACTTGGTCATGTCTCCGGACAGTCTCCTCAAGATTCGAAAGGGTATATCAGACACAATGTCGGTA
ACGATTGAGTATCTTCGAGATCGGTGGGATGCCTCGGTCGCCGGGGCCATGGGTTTGCATCCCGACGCCCGAGTT
GGCAACGCCGAGACGGCAACCGGCTCACACCGAACCTTGGCATGGGACTCGATTGCGAACTCGGCCGATGACGAT
CCGTTGGTACTGTCCGCTGTCCGCACGCTGGCGCTCTGGCTGAGGGAGGATGAAAACGAGCTGTTGCGCAAGGAG
GCGACGGGATTAACGGACATGTTTATGGATCTCTACCGGGGGAGCGCGCCGGGAAAGCTCGACTTCAGGTCGCCC
ATACTCGTTGCACTGGAGGCCTTGGTCGAACTGGATAAGGGGCGGGACCTCCTCCTCCGCCATGATGGCTGGCAG
ATCCTTTGCAAAGATCTGACTGACATACTCAACGACACATCAACCACCAACGACAAGGACGGGACCTCTCGCGGC
ATCGAAATCGTCCGTGTCCTCGTTCAGGTCGTGGAACAGGAGTCAACCGGTACGGCAGAGGCGTGGATGGATCTG
ATTACCACCGTTGCCGCCTGGGACGTACCCGTTCAGGAGCGGCCGCTCGAGGCGAAAGAGTTTCAACTTGCGGTG
TTGGAATTGTGTTGCGCGCTGCTGCTGGGGGCGAGCAACGGTATGCGAAACAGATATAGGCACTCGTTCAAAGCA
GTCGCGGGTATCGCAACGCGGATGAGGCCCTTGATGGCGTGTGATGGTCGCCTGAGCGGGCCGATGCAGGATGTC
CTGGAGACCTTGAACGGCAACGTCTCGAAGAGCGACTGA
Gene >Ophio5|4045
ATGGACAAGCCACAGCCGGCTCAAAAGCCCAGCGCTGATCCGCCACCCGTCGATGCCGCCAGCTTGGCCAACATC
CAGAGCCTCCTACAGGCACGCGACGACACGCAGAGATTCGTCGGTCTGGCTCTGCTCAAGTCTGTTCTCGACAAC
TCGCAGCTACTTCGCCAGGACGAAGCCGTCATCAAGTCGCTATGGGAGAGCCTGTCTGCCAAGTTCTTAGACAGG
CTGCTACGCACAGGGTCCAACCCGGCAAATCAACACGCAAGCGACATGCTGGACCTGGCCGTCTCCGTCTTGCAC
ACATTTGCTGCCCTACTGCCCGAGAGTTCGCGGGCAGATGCCAAGTTTACTGCCAGAATACCTGGCCTGGTCGGA
ACCATCCTGTGCAGGTGAGAAGTCTCCAATCAGCCCTTTTGCTCTCTCCGCCCTGACCTTGAGCGCACAGTTCCG
ACGAGACTATCGGCCTCACCCTGCAGCTCCTTCATACACTTGTCAGCTTGCCTCAAGGGGCTCGCATTCTCGTCA
ACTGCCAGGATCTGAGCCCCCTCACCGAGAATGCGCCATCGCATCCCCTCGTCCTAGACATCCTGGGCTTTGCAT
GGCTCAATGGCATGGCGGACGCCGAGAATAGACTTGTGCTTTCACAAAAAATAGACGCAACCCTGAAAAGCCTCT
CCTCCTCTTTCACCGGCACGGATGCCGTCATATTCCTTGAGTTTCTTGGAACTTTCCTGCGACAGGCGGATCCTG
CTGTAGGTCGACGCACCCACATACAATTCGCTTTGTCTACAGCATGGCTAAGGCTGCCCAGGTATTGCCCAAAGA
CCCCAAGTGGCTCAGTAAAGTATGCGGTTACATTCACAGTCTTGCCATGAGTCGACCGACTCCTGAAGCAAGGTC
TGCCTACACGAATGCTGCCGCGTCTCTTGTCCAGATCTATCCAAATCAGGCCCCGAAGCTCCTATTCACGGATGA
TCGTAGCGCAGACAAAGCTCCCGCCTATCTTCTCATGAATCTCCTACTCATCGATATCCGCTCATCCGCGCCGAC
GCTTCTGGGCCAGCTCAACGCGCGAGACAGCGCTGCAACGACAAGACGATTGGCGTCGGCATTCGACGTCGTCTG
CATCTTTGTGGGATTCCTGGCTCGATTTCTCGACGGTGACTGTCAAGATGACTTGGTCATGTCTCCGGACAGTCT
CCTCAAGATTCGAAAGGGTATATCAGACACAATGTCGGTAACGATTGAGTATCTTCGAGATCGGTGGGATGCCTC
GGTCGCCGGGGCCATGGGTTTGCATCCCGACGCCCGAGTTGGCAACGCCGAGACGGCAACCGGCTCACACCGAAC
CTTGGCATGGGACTCGATTGCGAACTCGGCCGATGACGATCCGTTGGTACTGTCCGCTGTCCGCACGCTGGCGCT
CTGGCTGAGGGAGGATGAAAACGAGCTGTTGCGCAAGGAGGCGACGGGATTAACGGACATGTTTATGGATCTCTA
CCGGGGGAGCGCGCCGGGAAAGCTCGACTTCAGGTCGCCCATACTCGTTGCACTGGAGGCCTTGGTCGAACTGGA
TAAGGGGCGGGACCTCCTCCTCCGCCATGATGGCTGGCAGATCCTTTGCAAAGATCTGACTGACATACTCAACGA
CACATCAACCACCAACGACAAGGACGGGACCTCTCGCGGCATCGAAATCGTCCGTGTCCTCGTTCAGGTCGTGGA
ACAGGAGTCAACCGGTACGGCAGAGGCGTGGATGGATCTGATTACCACCGTTGCCGCCTGGGACGTACCCGTTCA
GGAGCGGCCGCTCGAGGCGAAAGAGTTTCAACTTGCGGTGTTGGAATTGTGTTGCGCGCTGCTGCTGGGGGCGAG
CAACGGTATGCGAAACAGATATAGGCACTCGTTCAAAGCAGTCGCGGGTATCGCAACGCGGATGAGGCCCTTGAT
GGCGTGTGATGGTCGCCTGAGCGGGCCGATGCAGGATGTCCTGGAGACCTTGAACGGCAACGTCTCGAAGAGCGA
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail