Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4040
Gene name
Locationscaffold_315:22771..23488
Strand-
Gene length (bp)717
Transcript length (bp)717
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 2.5E-18 11 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q51MB1|PALI_MAGO7 pH-response regulator protein palI/RIM9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM9 PE=3 SV=1 51 206 3.0E-07
sp|Q7Z8R5|PALI_YARLI pH-response regulator protein palI/RIM9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM9 PE=3 SV=3 13 224 1.0E-06

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 107 129 22
3 136 158 22
4 173 195 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2255.41 766.67 3744.16
CcL In ants, during behavior modification 324.38 61.42 587.33
CcD In ants, recently dead 153.36 83.45 223.27

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.028174 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4040
MGFGTFVHHIGTLLLLVATVLLIVVDVTAPVVDYLAIMRVHLGQNVQGSQVTFGSWGYCHRGIRDTDQCSNRHIG
YNPAQVMHEIDGTDFSSAAENTSKALTRVMILHPVATGLCFLAFLLCLSAGIVGSILASAFSLLAFIVTIVAMAC
DFVAFGIIKHDVNANGHSRAHWASGIWCILAAAIFTLVASLIVLLTCCASRAKKRRHLGQDHKETVDTTTVVGAR
QPFWKRLPLKPSS
Coding >Ophio5|4040
ATGGGCTTCGGCACCTTTGTCCATCACATCGGCACCCTGTTGCTACTCGTCGCCACCGTCCTTCTCATCGTCGTC
GATGTCACCGCCCCCGTCGTCGACTACCTCGCCATCATGCGCGTCCATCTCGGTCAGAATGTACAGGGCTCGCAG
GTGACGTTTGGCAGCTGGGGTTATTGCCATCGGGGCATTCGCGATACCGATCAGTGCTCCAATCGACACATCGGT
TATAATCCGGCCCAGGTCATGCACGAAATCGACGGCACCGACTTCAGTTCGGCCGCCGAGAATACGTCCAAGGCT
CTCACTCGTGTCATGATCTTGCATCCCGTCGCCACCGGCCTCTGCTTCCTCGCCTTTCTCCTCTGCCTCAGCGCC
GGCATCGTCGGCTCCATCCTGGCTTCGGCCTTTTCCCTACTGGCCTTTATCGTCACCATCGTCGCCATGGCCTGT
GATTTCGTCGCCTTTGGCATCATCAAACACGACGTCAACGCAAACGGTCACAGTCGTGCTCACTGGGCCTCGGGC
ATCTGGTGTATCCTCGCCGCCGCCATCTTCACCCTCGTCGCCTCCCTCATCGTCCTGCTCACCTGCTGCGCCAGC
CGAGCCAAGAAGCGTCGCCATCTTGGTCAAGATCACAAGGAGACCGTCGATACGACGACCGTCGTCGGTGCGCGT
CAGCCATTCTGGAAACGCTTGCCTCTGAAGCCATCGTCG
Transcript >Ophio5|4040
ATGGGCTTCGGCACCTTTGTCCATCACATCGGCACCCTGTTGCTACTCGTCGCCACCGTCCTTCTCATCGTCGTC
GATGTCACCGCCCCCGTCGTCGACTACCTCGCCATCATGCGCGTCCATCTCGGTCAGAATGTACAGGGCTCGCAG
GTGACGTTTGGCAGCTGGGGTTATTGCCATCGGGGCATTCGCGATACCGATCAGTGCTCCAATCGACACATCGGT
TATAATCCGGCCCAGGTCATGCACGAAATCGACGGCACCGACTTCAGTTCGGCCGCCGAGAATACGTCCAAGGCT
CTCACTCGTGTCATGATCTTGCATCCCGTCGCCACCGGCCTCTGCTTCCTCGCCTTTCTCCTCTGCCTCAGCGCC
GGCATCGTCGGCTCCATCCTGGCTTCGGCCTTTTCCCTACTGGCCTTTATCGTCACCATCGTCGCCATGGCCTGT
GATTTCGTCGCCTTTGGCATCATCAAACACGACGTCAACGCAAACGGTCACAGTCGTGCTCACTGGGCCTCGGGC
ATCTGGTGTATCCTCGCCGCCGCCATCTTCACCCTCGTCGCCTCCCTCATCGTCCTGCTCACCTGCTGCGCCAGC
CGAGCCAAGAAGCGTCGCCATCTTGGTCAAGATCACAAGGAGACCGTCGATACGACGACCGTCGTCGGTGCGCGT
CAGCCATTCTGGAAACGCTTGCCTCTGAAGCCATCGTCGTAG
Gene >Ophio5|4040
ATGGGCTTCGGCACCTTTGTCCATCACATCGGCACCCTGTTGCTACTCGTCGCCACCGTCCTTCTCATCGTCGTC
GATGTCACCGCCCCCGTCGTCGACTACCTCGCCATCATGCGCGTCCATCTCGGTCAGAATGTACAGGGCTCGCAG
GTGACGTTTGGCAGCTGGGGTTATTGCCATCGGGGCATTCGCGATACCGATCAGTGCTCCAATCGACACATCGGT
TATAATCCGGCCCAGGTCATGCACGAAATCGACGGCACCGACTTCAGTTCGGCCGCCGAGAATACGTCCAAGGCT
CTCACTCGTGTCATGATCTTGCATCCCGTCGCCACCGGCCTCTGCTTCCTCGCCTTTCTCCTCTGCCTCAGCGCC
GGCATCGTCGGCTCCATCCTGGCTTCGGCCTTTTCCCTACTGGCCTTTATCGTCACCATCGTCGCCATGGCCTGT
GATTTCGTCGCCTTTGGCATCATCAAACACGACGTCAACGCAAACGGTCACAGTCGTGCTCACTGGGCCTCGGGC
ATCTGGTGTATCCTCGCCGCCGCCATCTTCACCCTCGTCGCCTCCCTCATCGTCCTGCTCACCTGCTGCGCCAGC
CGAGCCAAGAAGCGTCGCCATCTTGGTCAAGATCACAAGGAGACCGTCGATACGACGACCGTCGTCGGTGCGCGT
CAGCCATTCTGGAAACGCTTGCCTCTGAAGCCATCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail