Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4040
Gene name
Locationscaffold_315:22771..23488
Strand-
Gene length (bp)717
Transcript length (bp)717
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 2.5E-18 11 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q51MB1|PALI_MAGO7 pH-response regulator protein palI/RIM9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM9 PE=3 SV=1 51 206 3.0E-07
sp|Q7Z8R5|PALI_YARLI pH-response regulator protein palI/RIM9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM9 PE=3 SV=3 13 224 1.0E-06

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 107 129 22
3 136 158 22
4 173 195 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4040
MGFGTFVHHIGTLLLLVATVLLIVVDVTAPVVDYLAIMRVHLGQNVQGSQVTFGSWGYCHRGIRDTDQCSNRHIG
YNPAQVMHEIDGTDFSSAAENTSKALTRVMILHPVATGLCFLAFLLCLSAGIVGSILASAFSLLAFIVTIVAMAC
DFVAFGIIKHDVNANGHSRAHWASGIWCILAAAIFTLVASLIVLLTCCASRAKKRRHLGQDHKETVDTTTVVGAR
QPFWKRLPLKPSS
Coding >Ophio5|4040
ATGGGCTTCGGCACCTTTGTCCATCACATCGGCACCCTGTTGCTACTCGTCGCCACCGTCCTTCTCATCGTCGTC
GATGTCACCGCCCCCGTCGTCGACTACCTCGCCATCATGCGCGTCCATCTCGGTCAGAATGTACAGGGCTCGCAG
GTGACGTTTGGCAGCTGGGGTTATTGCCATCGGGGCATTCGCGATACCGATCAGTGCTCCAATCGACACATCGGT
TATAATCCGGCCCAGGTCATGCACGAAATCGACGGCACCGACTTCAGTTCGGCCGCCGAGAATACGTCCAAGGCT
CTCACTCGTGTCATGATCTTGCATCCCGTCGCCACCGGCCTCTGCTTCCTCGCCTTTCTCCTCTGCCTCAGCGCC
GGCATCGTCGGCTCCATCCTGGCTTCGGCCTTTTCCCTACTGGCCTTTATCGTCACCATCGTCGCCATGGCCTGT
GATTTCGTCGCCTTTGGCATCATCAAACACGACGTCAACGCAAACGGTCACAGTCGTGCTCACTGGGCCTCGGGC
ATCTGGTGTATCCTCGCCGCCGCCATCTTCACCCTCGTCGCCTCCCTCATCGTCCTGCTCACCTGCTGCGCCAGC
CGAGCCAAGAAGCGTCGCCATCTTGGTCAAGATCACAAGGAGACCGTCGATACGACGACCGTCGTCGGTGCGCGT
CAGCCATTCTGGAAACGCTTGCCTCTGAAGCCATCGTCG
Transcript >Ophio5|4040
ATGGGCTTCGGCACCTTTGTCCATCACATCGGCACCCTGTTGCTACTCGTCGCCACCGTCCTTCTCATCGTCGTC
GATGTCACCGCCCCCGTCGTCGACTACCTCGCCATCATGCGCGTCCATCTCGGTCAGAATGTACAGGGCTCGCAG
GTGACGTTTGGCAGCTGGGGTTATTGCCATCGGGGCATTCGCGATACCGATCAGTGCTCCAATCGACACATCGGT
TATAATCCGGCCCAGGTCATGCACGAAATCGACGGCACCGACTTCAGTTCGGCCGCCGAGAATACGTCCAAGGCT
CTCACTCGTGTCATGATCTTGCATCCCGTCGCCACCGGCCTCTGCTTCCTCGCCTTTCTCCTCTGCCTCAGCGCC
GGCATCGTCGGCTCCATCCTGGCTTCGGCCTTTTCCCTACTGGCCTTTATCGTCACCATCGTCGCCATGGCCTGT
GATTTCGTCGCCTTTGGCATCATCAAACACGACGTCAACGCAAACGGTCACAGTCGTGCTCACTGGGCCTCGGGC
ATCTGGTGTATCCTCGCCGCCGCCATCTTCACCCTCGTCGCCTCCCTCATCGTCCTGCTCACCTGCTGCGCCAGC
CGAGCCAAGAAGCGTCGCCATCTTGGTCAAGATCACAAGGAGACCGTCGATACGACGACCGTCGTCGGTGCGCGT
CAGCCATTCTGGAAACGCTTGCCTCTGAAGCCATCGTCGTAG
Gene >Ophio5|4040
ATGGGCTTCGGCACCTTTGTCCATCACATCGGCACCCTGTTGCTACTCGTCGCCACCGTCCTTCTCATCGTCGTC
GATGTCACCGCCCCCGTCGTCGACTACCTCGCCATCATGCGCGTCCATCTCGGTCAGAATGTACAGGGCTCGCAG
GTGACGTTTGGCAGCTGGGGTTATTGCCATCGGGGCATTCGCGATACCGATCAGTGCTCCAATCGACACATCGGT
TATAATCCGGCCCAGGTCATGCACGAAATCGACGGCACCGACTTCAGTTCGGCCGCCGAGAATACGTCCAAGGCT
CTCACTCGTGTCATGATCTTGCATCCCGTCGCCACCGGCCTCTGCTTCCTCGCCTTTCTCCTCTGCCTCAGCGCC
GGCATCGTCGGCTCCATCCTGGCTTCGGCCTTTTCCCTACTGGCCTTTATCGTCACCATCGTCGCCATGGCCTGT
GATTTCGTCGCCTTTGGCATCATCAAACACGACGTCAACGCAAACGGTCACAGTCGTGCTCACTGGGCCTCGGGC
ATCTGGTGTATCCTCGCCGCCGCCATCTTCACCCTCGTCGCCTCCCTCATCGTCCTGCTCACCTGCTGCGCCAGC
CGAGCCAAGAAGCGTCGCCATCTTGGTCAAGATCACAAGGAGACCGTCGATACGACGACCGTCGTCGGTGCGCGT
CAGCCATTCTGGAAACGCTTGCCTCTGAAGCCATCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail