Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4039
Gene name
Locationscaffold_315:21202..22354
Strand+
Gene length (bp)1152
Transcript length (bp)738
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01596 Methyltransf_3 O-methyltransferase 9.0E-32 40 242
PF13578 Methyltransf_24 Methyltransferase domain 1.0E-08 73 184
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 6.6E-09 68 148
PF13847 Methyltransf_31 Methyltransferase domain 6.3E-08 69 160
PF13649 Methyltransf_25 Methyltransferase domain 8.2E-07 72 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86IC9|CAMT1_DICDI Probable caffeoyl-CoA O-methyltransferase 1 OS=Dictyostelium discoideum GN=omt5 PE=3 SV=1 16 241 4.0E-27
sp|Q86IC8|CAMT2_DICDI Probable caffeoyl-CoA O-methyltransferase 2 OS=Dictyostelium discoideum GN=omt6 PE=1 SV=1 1 241 4.0E-26
sp|Q55AS5|CAMT3_DICDI Probable caffeoyl-CoA O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt1 PE=2 SV=1 17 241 3.0E-25
sp|Q00719|MDMC_STRMY O-methyltransferase MdmC OS=Streptomyces mycarofaciens GN=mdmC PE=3 SV=1 56 245 2.0E-22
sp|Q9XGD5|CAMT2_MAIZE Caffeoyl-CoA O-methyltransferase 2 OS=Zea mays GN=CCOAOMT2 PE=2 SV=1 50 242 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86IC9|CAMT1_DICDI Probable caffeoyl-CoA O-methyltransferase 1 OS=Dictyostelium discoideum GN=omt5 PE=3 SV=1 16 241 4.0E-27
sp|Q86IC8|CAMT2_DICDI Probable caffeoyl-CoA O-methyltransferase 2 OS=Dictyostelium discoideum GN=omt6 PE=1 SV=1 1 241 4.0E-26
sp|Q55AS5|CAMT3_DICDI Probable caffeoyl-CoA O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt1 PE=2 SV=1 17 241 3.0E-25
sp|Q00719|MDMC_STRMY O-methyltransferase MdmC OS=Streptomyces mycarofaciens GN=mdmC PE=3 SV=1 56 245 2.0E-22
sp|Q9XGD5|CAMT2_MAIZE Caffeoyl-CoA O-methyltransferase 2 OS=Zea mays GN=CCOAOMT2 PE=2 SV=1 50 242 4.0E-20
sp|Q9XGP7|OMT15_ORYSJ Tricin synthase 1 OS=Oryza sativa subsp. japonica GN=ROMT-15 PE=1 SV=1 50 242 3.0E-19
sp|P28034|CAMT_PETCR Caffeoyl-CoA O-methyltransferase OS=Petroselinum crispum PE=1 SV=1 50 242 4.0E-18
sp|Q40313|CAMT_MEDSA Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1 50 242 4.0E-18
sp|O65922|CAMT2_POPTR Caffeoyl-CoA O-methyltransferase 2 OS=Populus trichocarpa GN=CCOAOMT2 PE=2 SV=1 50 242 7.0E-18
sp|O65862|CAMT1_POPTR Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1 50 242 1.0E-17
sp|Q43095|CAMT_POPTM Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1 50 242 1.0E-17
sp|Q9SWB8|CAMT2_EUCGL Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus globulus GN=CCOAOMT2 PE=2 SV=1 50 242 1.0E-17
sp|O81185|CAMT1_EUCGL Caffeoyl-CoA O-methyltransferase 1 OS=Eucalyptus globulus GN=CCOMT PE=2 SV=1 50 242 2.0E-17
sp|O04854|CAMT_EUCGU Caffeoyl-CoA O-methyltransferase OS=Eucalyptus gunnii PE=2 SV=1 50 242 2.0E-17
sp|O04899|CAMT5_TOBAC Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1 50 242 2.0E-17
sp|O24150|CAMT3_TOBAC Caffeoyl-CoA O-methyltransferase 3 OS=Nicotiana tabacum GN=CCOAOMT3 PE=2 SV=2 50 242 4.0E-17
sp|Q42945|CAMT6_TOBAC Caffeoyl-CoA O-methyltransferase 6 OS=Nicotiana tabacum GN=CCOAOMT6 PE=2 SV=1 50 242 5.0E-17
sp|Q43237|CAMT_VITVI Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera PE=2 SV=1 50 242 5.0E-17
sp|O24149|CAMT2_TOBAC Caffeoyl-CoA O-methyltransferase 2 OS=Nicotiana tabacum GN=CCOAOMT2 PE=2 SV=1 50 242 1.0E-16
sp|Q8H9B6|CAMT_SOLTU Caffeoyl-CoA O-methyltransferase OS=Solanum tuberosum GN=CCOAOMT PE=2 SV=1 50 242 1.0E-16
sp|O49499|CAMT4_ARATH Caffeoyl-CoA O-methyltransferase 1 OS=Arabidopsis thaliana GN=CCOAOMT1 PE=1 SV=1 50 242 1.0E-16
sp|O24144|CAMT1_TOBAC Caffeoyl-CoA O-methyltransferase 1 OS=Nicotiana tabacum GN=CCOAOMT1 PE=1 SV=1 50 242 2.0E-16
sp|O24151|CAMT4_TOBAC Caffeoyl-CoA O-methyltransferase 4 OS=Nicotiana tabacum GN=CCOAOMT4 PE=2 SV=1 50 242 2.0E-16
sp|Q43161|CAMT_STELP Caffeoyl-CoA O-methyltransferase OS=Stellaria longipes PE=2 SV=1 40 242 2.0E-16
sp|Q9C9W3|CAMT1_ARATH Putative caffeoyl-CoA O-methyltransferase At1g67980 OS=Arabidopsis thaliana GN=At1g67980 PE=2 SV=1 48 242 3.0E-16
sp|P93711|CAMT_POPKI Caffeoyl-CoA O-methyltransferase OS=Populus kitakamiensis PE=2 SV=1 56 242 4.0E-16
sp|Q9C9W4|TSM1_ARATH Tapetum-specific methyltransferase 1 OS=Arabidopsis thaliana GN=TSM1 PE=1 SV=2 56 242 8.0E-16
sp|O65162|CAMT_MESCR Caffeoyl-CoA O-methyltransferase OS=Mesembryanthemum crystallinum PE=2 SV=1 50 242 1.0E-15
sp|Q9ZTT5|CAMT_PINTA Caffeoyl-CoA O-methyltransferase OS=Pinus taeda GN=CCOAOMT PE=2 SV=1 50 242 1.0E-15
sp|Q7F8T6|OMT17_ORYSJ Tricin synthase 2 OS=Oryza sativa subsp. japonica GN=ROMT-17 PE=1 SV=1 50 242 2.0E-15
sp|Q9XGD6|CAMT1_MAIZE Caffeoyl-CoA O-methyltransferase 1 OS=Zea mays GN=CCOAOMT1 PE=2 SV=1 50 242 6.0E-15
sp|Q41720|CAMT_ZINVI Caffeoyl-CoA O-methyltransferase OS=Zinnia violacea GN=CCOAOMT PE=2 SV=1 50 242 8.0E-15
sp|Q9SLP8|CAMT_CITNA Caffeoyl-CoA O-methyltransferase OS=Citrus natsudaidai PE=3 SV=1 50 242 3.0E-13
sp|Q9C5D7|CAMT3_ARATH Probable caffeoyl-CoA O-methyltransferase At4g26220 OS=Arabidopsis thaliana GN=At4g26220 PE=2 SV=1 58 242 3.0E-13
sp|Q8BIG7|CMTD1_MOUSE Catechol O-methyltransferase domain-containing protein 1 OS=Mus musculus GN=Comtd1 PE=1 SV=1 44 240 4.0E-13
sp|O32036|YRRM_BACSU Putative O-methyltransferase YrrM OS=Bacillus subtilis (strain 168) GN=yrrM PE=3 SV=1 70 240 8.0E-12
sp|O88587|COMT_MOUSE Catechol O-methyltransferase OS=Mus musculus GN=Comt PE=1 SV=2 3 203 1.0E-11
sp|Q5H879|COMT_HORSE Catechol O-methyltransferase OS=Equus caballus GN=COMT PE=2 SV=1 8 189 1.0E-11
sp|C7AE94|FAOMT_VITVI Flavonoid 3',5'-methyltransferase OS=Vitis vinifera GN=FAOMT PE=1 SV=1 59 242 3.0E-11
sp|A7MBI7|COMT_BOVIN Catechol O-methyltransferase OS=Bos taurus GN=COMT PE=2 SV=1 8 203 4.0E-11
sp|P22734|COMT_RAT Catechol O-methyltransferase OS=Rattus norvegicus GN=Comt PE=1 SV=2 50 203 5.0E-11
sp|Q99028|COMT_PIG Catechol O-methyltransferase (Fragment) OS=Sus scrofa GN=COMT PE=1 SV=1 72 189 5.0E-10
sp|Q86VU5|CMTD1_HUMAN Catechol O-methyltransferase domain-containing protein 1 OS=Homo sapiens GN=COMTD1 PE=1 SV=1 44 240 1.0E-09
sp|P21964|COMT_HUMAN Catechol O-methyltransferase OS=Homo sapiens GN=COMT PE=1 SV=2 72 189 2.0E-09
sp|O42898|COMT1_SCHPO Probable catechol O-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC119.03 PE=3 SV=1 50 189 5.0E-09
sp|A0QCH0|Y1364_MYCA1 Putative O-methyltransferase MAV_1364 OS=Mycobacterium avium (strain 104) GN=MAV_1364 PE=3 SV=1 53 245 2.0E-08
sp|A4T8W9|Y2199_MYCGI Putative O-methyltransferase Mflv_2199 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_2199 PE=3 SV=2 25 238 3.0E-08
sp|Q73WV2|Y2558_MYCPA Putative O-methyltransferase MAP_2558 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_2558 PE=3 SV=2 53 245 3.0E-08
sp|Q8NKC1|COMT2_SCHPO Probable catechol O-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB21E7.04c PE=3 SV=1 65 189 5.0E-08
sp|A3Q3Q7|Y4009_MYCSJ Putative O-methyltransferase Mjls_4009 OS=Mycobacterium sp. (strain JLS) GN=Mjls_4009 PE=3 SV=2 14 245 7.0E-08
sp|B2HS47|Y4217_MYCMM Putative O-methyltransferase MMAR_4217 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_4217 PE=3 SV=1 53 245 1.0E-07
sp|B6CZ56|TOMT_PROCO Transmembrane O-methyltransferase OS=Propithecus coquereli GN=LRTOMT PE=2 SV=2 72 189 1.0E-07
sp|B6CZ46|TOMT_MACMU Transmembrane O-methyltransferase OS=Macaca mulatta GN=LRTOMT PE=2 SV=2 72 189 2.0E-07
sp|Q56308|PIMT_THEMA Protein-L-isoaspartate O-methyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pcm PE=1 SV=1 27 151 2.0E-07
sp|A1KI08|Y1280_MYCBP Putative O-methyltransferase BCG_1280c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1280c PE=3 SV=2 53 245 3.0E-07
sp|Q7U0D0|Y1252_MYCBO Putative O-methyltransferase Mb1252c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1252c PE=3 SV=2 53 245 3.0E-07
sp|A5U1R8|Y1229_MYCTA Putative O-methyltransferase MRA_1229 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1229 PE=3 SV=2 53 245 3.0E-07
sp|P9WJZ7|Y1220_MYCTU Putative O-methyltransferase Rv1220c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1220c PE=1 SV=2 53 245 3.0E-07
sp|P9WJZ6|Y1220_MYCTO Putative O-methyltransferase MT1258 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1258 PE=3 SV=2 53 245 3.0E-07
sp|A1TDM2|Y4497_MYCVP Putative O-methyltransferase Mvan_4497 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_4497 PE=3 SV=2 25 238 4.0E-07
sp|A8AAV7|PIMT_IGNH4 Protein-L-isoaspartate O-methyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pcm PE=3 SV=1 71 148 5.0E-07
sp|Q8WZ04|TOMT_HUMAN Transmembrane O-methyltransferase OS=Homo sapiens GN=LRTOMT PE=1 SV=3 72 189 6.0E-07
sp|P86243|TOMT_PANTR Transmembrane O-methyltransferase OS=Pan troglodytes GN=LRTOMT PE=2 SV=1 72 189 6.0E-07
sp|O27962|PIMT2_ARCFU Protein-L-isoaspartate O-methyltransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm2 PE=3 SV=1 71 148 7.0E-07
sp|A0PVW4|Y4520_MYCUA Putative O-methyltransferase MUL_4520 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_4520 PE=3 SV=1 53 245 2.0E-06
sp|A0R2D5|Y5073_MYCS2 Putative O-methyltransferase MSMEG_5073/MSMEI_4947 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5073 PE=1 SV=1 61 245 2.0E-06
sp|A1Y9I9|TOMT_MOUSE Transmembrane O-methyltransferase OS=Mus musculus GN=Tomt PE=1 SV=1 72 189 3.0E-06
sp|A1UKA3|Y4069_MYCSK Putative O-methyltransferase Mkms_4069 OS=Mycobacterium sp. (strain KMS) GN=Mkms_4069 PE=3 SV=2 14 238 5.0E-06
sp|Q1B4T4|Y3995_MYCSS Putative O-methyltransferase Mmcs_3995 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_3995 PE=3 SV=2 14 238 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4039
MKQGEASHLYSSASTGNKVLAYAHHHSSALPASLVAYHARAADSRADSDMLSSNAQSQFHSFLARAIGAKRVLEV
GVYVGYSAMAWAHAVGPEGRVTGLECSADLAAVARAAMAEHGIDNVDIILGNAAETLPVLQPTEPYDIVFLDADK
DGYIRYLETLLSASPPDASSGRLLRPGALIIADNVLRSGHVADDSLPFDRSKSEEDWRKQIDAIRRFNDTCVAEK
RLETFMVPLWDGVSLLRLRD
Coding >Ophio5|4039
ATGAAGCAAGGCGAAGCAAGTCATCTGTACAGTAGCGCCTCGACCGGCAACAAGGTGCTGGCCTACGCGCACCAT
CACTCGTCGGCGCTGCCGGCCAGCCTCGTCGCCTACCACGCCCGTGCGGCGGACAGCAGGGCGGATTCGGACATG
TTGTCGTCGAATGCGCAGTCGCAGTTTCATTCGTTTCTGGCGAGGGCGATAGGGGCTAAGCGCGTGCTCGAAGTC
GGCGTCTACGTCGGCTACTCGGCCATGGCCTGGGCCCACGCCGTCGGTCCGGAGGGCCGAGTCACGGGCCTCGAA
TGCTCGGCCGACTTGGCTGCTGTTGCTCGGGCGGCTATGGCGGAGCATGGCATCGACAACGTCGATATTATTCTT
GGCAATGCTGCCGAAACCCTCCCCGTCCTCCAACCCACCGAGCCATACGACATCGTCTTCCTCGACGCCGACAAA
GACGGCTACATCCGCTACCTCGAGACGCTTCTATCCGCCTCGCCTCCCGACGCCTCTTCCGGCCGTCTCCTCCGG
CCCGGGGCTCTCATCATCGCCGACAACGTCCTGCGCTCCGGTCACGTGGCGGATGACTCGTTGCCGTTTGACAGG
TCGAAATCGGAGGAGGATTGGCGTAAACAAATCGACGCCATTCGCAGGTTCAACGATACGTGCGTTGCCGAGAAG
AGGCTGGAGACGTTTATGGTGCCGTTGTGGGATGGCGTGAGCTTGCTGAGGCTGCGTGAT
Transcript >Ophio5|4039
ATGAAGCAAGGCGAAGCAAGTCATCTGTACAGTAGCGCCTCGACCGGCAACAAGGTGCTGGCCTACGCGCACCAT
CACTCGTCGGCGCTGCCGGCCAGCCTCGTCGCCTACCACGCCCGTGCGGCGGACAGCAGGGCGGATTCGGACATG
TTGTCGTCGAATGCGCAGTCGCAGTTTCATTCGTTTCTGGCGAGGGCGATAGGGGCTAAGCGCGTGCTCGAAGTC
GGCGTCTACGTCGGCTACTCGGCCATGGCCTGGGCCCACGCCGTCGGTCCGGAGGGCCGAGTCACGGGCCTCGAA
TGCTCGGCCGACTTGGCTGCTGTTGCTCGGGCGGCTATGGCGGAGCATGGCATCGACAACGTCGATATTATTCTT
GGCAATGCTGCCGAAACCCTCCCCGTCCTCCAACCCACCGAGCCATACGACATCGTCTTCCTCGACGCCGACAAA
GACGGCTACATCCGCTACCTCGAGACGCTTCTATCCGCCTCGCCTCCCGACGCCTCTTCCGGCCGTCTCCTCCGG
CCCGGGGCTCTCATCATCGCCGACAACGTCCTGCGCTCCGGTCACGTGGCGGATGACTCGTTGCCGTTTGACAGG
TCGAAATCGGAGGAGGATTGGCGTAAACAAATCGACGCCATTCGCAGGTTCAACGATACGTGCGTTGCCGAGAAG
AGGCTGGAGACGTTTATGGTGCCGTTGTGGGATGGCGTGAGCTTGCTGAGGCTGCGTGATTGA
Gene >Ophio5|4039
ATGAAGCAAGGCGAAGCAAGTCATCTGTACAGTAGCGCCTCGACCGGCAACAAGGTGCTGGCCTACGCGCACCAT
CACTCGTCGGCGCTGCCGGCCAGCCTCGTCGCCTACCACGCCCGTGCGGCGGACAGCAGGGCGGATTCGGACATG
TTGTCGTCGAATGCGCAGTCGCAGTTTCATTCGTTTCTGGCGAGGGCGATAGGGGCTAAGCGCGGTATGTTTTTC
CTTATTCTCTTCTTTTTCTTCTTCCTTCTTCCTTCTTCCTTCTTTTCACTCTCGACTCTTCTTACTAAAAAATGC
CGCAACAGTGCTCGAAGTCGGCGTCTACGTCGGCTACTCGGCCATGGCCTGGGCCCACGCCGTCGGTCCGGAGGG
CCGAGTCACGGGCCTCGAATGCTCGGCCGACTTGGCTGCTGTTGCTCGGGCGGCTATGGCGGAGCATGGCATCGA
CAACGTCGATATTATTCTTGGCAATGCTGCCGAAACGTGCGTCTCTCTTCTCTTTTCTTCTCTCATCTCATCCTC
TCTCTCTCTCTCTCTCTTTCTTTCTTTTCCCCTCACTTCTCTCCTTTGCACCCGATTATCCCGTCTTACATGAAT
CCTGCCTTTCGTCTTACCCCATCCCTCTCGCTTACATTGGTCCTACCCACCCCGTGCAACTCAGCAGACGAGTAG
TCGAAACCCCTATTATTTTAACCCAGCAGACGAGTATTTAAAACCCCTATTATTGTAATATCTATTAAAAAAAGG
AGAGAAAGAGGGAGAGATAGAGAGAGAGGCAGAAAAAGGGGGTCTGACGTCTACAGCCTCCCCGTCCTCCAACCC
ACCGAGCCATACGACATCGTCTTCCTCGACGCCGACAAAGACGGCTACATCCGCTACCTCGAGACGCTTCTATCC
GCCTCGCCTCCCGACGCCTCTTCCGGCCGTCTCCTCCGGCCCGGGGCTCTCATCATCGCCGACAACGTCCTGCGC
TCCGGTCACGTGGCGGATGACTCGTTGCCGTTTGACAGGTCGAAATCGGAGGAGGATTGGCGTAAACAAATCGAC
GCCATTCGCAGGTTCAACGATACGTGCGTTGCCGAGAAGAGGCTGGAGACGTTTATGGTGCCGTTGTGGGATGGC
GTGAGCTTGCTGAGGCTGCGTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail