Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4038
Gene name
Locationscaffold_315:18539..20255
Strand+
Gene length (bp)1716
Transcript length (bp)1716
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 365 523 7.0E-06
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 358 486 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 548 570 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.64 1.02 6.26
CcL In ants, during behavior modification 0.53 0.00 1.12
CcD In ants, recently dead 1.03 0.06 2.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000770 yes
SC16a CcD 0.004461 yes
CcL CcD 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4038
MQTKAIALLALMGSAAAQKQVTDKVSGEKPTSKVLDAPGSATTEKPTKPLGIKGRPFAVSTTTTTTTTTRIRYIV
VPANLTTAKTTATKPTKAATTTTTKTKIGNLTGMTRAPTVWKPSKVTETSKVAEPSQSVKPKGTIWKRAVVDGEG
ESNNEQSRSVRINTNNDEESSSNSNSNSNSNSNSNSNSNSNSNSNSNDQQLQQQQQQQQQQLNQIRENLLLAQQQ
QQQLDNRNSNNDNNTNKKIDNDRNRVIVLERGGRGDGPGPGRGHGHGPIVHSGNCRGCRDNDRCQGGHCHGRSNC
HERCRKYIVAHGHHHHHDGHVHRGHFREHRFRGQRQCREKGCEKRKECKDKECKKEVKEVKPAPAPAAPSASVAP
APAPAPAPAPAPAPAPAVPAPAAPCVAVPCVLAPAPPAAAPAPPAAAPAPPAENQPAPAAPAPAPPAAAPAPPAA
APAPPAAAPAPPAAAPAPPAAAPAPPAEAAPAPPAEAAPAPAPGSGGGSPPAGSAPSPGSGTQPSSPAESGPAPG
SSSPPATYQPPSSPPATVINGASMMTTGSGLAVAVAVAVVANLFVL
Coding >Ophio5|4038
ATGCAAACCAAGGCGATTGCCTTGCTGGCCCTGATGGGGTCAGCGGCGGCTCAGAAGCAGGTGACGGACAAGGTG
TCGGGCGAGAAGCCGACGTCGAAAGTACTCGACGCACCGGGTTCGGCCACGACGGAGAAGCCGACGAAGCCTTTG
GGCATCAAGGGTCGGCCGTTTGCTGTGTCGACGACGACGACGACGACGACGACGACGCGAATTCGCTATATCGTG
GTGCCGGCCAATCTGACGACGGCGAAGACGACGGCGACTAAGCCGACGAAGGCTGCGACTACGACTACGACTAAG
ACCAAGATTGGCAACTTGACGGGGATGACGAGAGCACCGACCGTGTGGAAGCCGTCCAAGGTGACGGAGACGTCC
AAGGTCGCCGAGCCTTCCCAGAGCGTCAAGCCGAAGGGGACGATTTGGAAGCGAGCTGTGGTCGACGGTGAGGGA
GAGAGCAACAATGAACAGTCCAGGTCTGTCCGTATCAACACCAATAACGATGAGGAGAGCAGCAGCAACAGCAAC
AGCAACAGCAACAGCAACAGTAACAGCAACAGTAACAGCAACAGCAACAGCAACAGCAACAGCAACGACCAGCAG
TTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCAACCAGATCCGGGAGAACCTCTTGCTCGCCCAGCAGCAG
CAGCAGCAGTTGGACAACAGGAACAGCAACAACGATAACAACACCAACAAAAAGATTGACAACGACAGGAACCGA
GTCATCGTGCTCGAGCGCGGCGGCCGAGGCGACGGTCCCGGTCCCGGCCGCGGCCACGGCCACGGCCCCATCGTC
CACAGCGGCAACTGCCGCGGCTGCCGCGACAACGACCGCTGCCAGGGAGGCCACTGCCACGGGCGGTCCAACTGC
CACGAGCGCTGCCGCAAGTACATCGTCGCCCACGGACACCACCACCACCACGACGGACACGTCCACCGCGGACAC
TTCCGCGAGCATCGCTTCCGAGGACAGCGTCAGTGCCGCGAAAAGGGGTGCGAGAAGAGGAAGGAGTGCAAGGAC
AAGGAGTGCAAGAAGGAGGTCAAGGAGGTCAAGCCCGCGCCCGCTCCGGCCGCTCCTTCGGCTTCGGTTGCGCCC
GCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCGGCTGTGCCCGCTCCGGCTGCGCCGTGT
GTGGCTGTGCCGTGTGTCCTTGCTCCGGCGCCTCCCGCTGCTGCCCCGGCGCCTCCCGCTGCTGCCCCGGCCCCT
CCGGCTGAGAACCAGCCTGCCCCGGCTGCGCCTGCTCCCGCTCCCCCGGCCGCAGCGCCCGCTCCCCCGGCCGCA
GCTCCTGCTCCCCCGGCCGCGGCTCCCGCACCCCCAGCTGCGGCTCCCGCTCCTCCGGCTGCGGCTCCGGCTCCC
CCTGCCGAAGCGGCTCCGGCTCCCCCGGCCGAAGCAGCTCCGGCTCCAGCTCCGGGCTCGGGTGGTGGCTCGCCT
CCCGCGGGATCGGCCCCTTCGCCAGGCTCGGGCACGCAGCCCTCTTCGCCTGCGGAGTCGGGACCGGCGCCCGGA
TCGAGCTCGCCCCCGGCGACGTACCAGCCGCCGTCGTCGCCTCCTGCGACGGTGATCAACGGCGCGTCGATGATG
ACGACGGGTTCCGGCCTGGCCGTCGCCGTTGCCGTTGCCGTCGTGGCCAACCTGTTCGTCCTG
Transcript >Ophio5|4038
ATGCAAACCAAGGCGATTGCCTTGCTGGCCCTGATGGGGTCAGCGGCGGCTCAGAAGCAGGTGACGGACAAGGTG
TCGGGCGAGAAGCCGACGTCGAAAGTACTCGACGCACCGGGTTCGGCCACGACGGAGAAGCCGACGAAGCCTTTG
GGCATCAAGGGTCGGCCGTTTGCTGTGTCGACGACGACGACGACGACGACGACGACGCGAATTCGCTATATCGTG
GTGCCGGCCAATCTGACGACGGCGAAGACGACGGCGACTAAGCCGACGAAGGCTGCGACTACGACTACGACTAAG
ACCAAGATTGGCAACTTGACGGGGATGACGAGAGCACCGACCGTGTGGAAGCCGTCCAAGGTGACGGAGACGTCC
AAGGTCGCCGAGCCTTCCCAGAGCGTCAAGCCGAAGGGGACGATTTGGAAGCGAGCTGTGGTCGACGGTGAGGGA
GAGAGCAACAATGAACAGTCCAGGTCTGTCCGTATCAACACCAATAACGATGAGGAGAGCAGCAGCAACAGCAAC
AGCAACAGCAACAGCAACAGTAACAGCAACAGTAACAGCAACAGCAACAGCAACAGCAACAGCAACGACCAGCAG
TTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCAACCAGATCCGGGAGAACCTCTTGCTCGCCCAGCAGCAG
CAGCAGCAGTTGGACAACAGGAACAGCAACAACGATAACAACACCAACAAAAAGATTGACAACGACAGGAACCGA
GTCATCGTGCTCGAGCGCGGCGGCCGAGGCGACGGTCCCGGTCCCGGCCGCGGCCACGGCCACGGCCCCATCGTC
CACAGCGGCAACTGCCGCGGCTGCCGCGACAACGACCGCTGCCAGGGAGGCCACTGCCACGGGCGGTCCAACTGC
CACGAGCGCTGCCGCAAGTACATCGTCGCCCACGGACACCACCACCACCACGACGGACACGTCCACCGCGGACAC
TTCCGCGAGCATCGCTTCCGAGGACAGCGTCAGTGCCGCGAAAAGGGGTGCGAGAAGAGGAAGGAGTGCAAGGAC
AAGGAGTGCAAGAAGGAGGTCAAGGAGGTCAAGCCCGCGCCCGCTCCGGCCGCTCCTTCGGCTTCGGTTGCGCCC
GCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCGGCTGTGCCCGCTCCGGCTGCGCCGTGT
GTGGCTGTGCCGTGTGTCCTTGCTCCGGCGCCTCCCGCTGCTGCCCCGGCGCCTCCCGCTGCTGCCCCGGCCCCT
CCGGCTGAGAACCAGCCTGCCCCGGCTGCGCCTGCTCCCGCTCCCCCGGCCGCAGCGCCCGCTCCCCCGGCCGCA
GCTCCTGCTCCCCCGGCCGCGGCTCCCGCACCCCCAGCTGCGGCTCCCGCTCCTCCGGCTGCGGCTCCGGCTCCC
CCTGCCGAAGCGGCTCCGGCTCCCCCGGCCGAAGCAGCTCCGGCTCCAGCTCCGGGCTCGGGTGGTGGCTCGCCT
CCCGCGGGATCGGCCCCTTCGCCAGGCTCGGGCACGCAGCCCTCTTCGCCTGCGGAGTCGGGACCGGCGCCCGGA
TCGAGCTCGCCCCCGGCGACGTACCAGCCGCCGTCGTCGCCTCCTGCGACGGTGATCAACGGCGCGTCGATGATG
ACGACGGGTTCCGGCCTGGCCGTCGCCGTTGCCGTTGCCGTCGTGGCCAACCTGTTCGTCCTGTGA
Gene >Ophio5|4038
ATGCAAACCAAGGCGATTGCCTTGCTGGCCCTGATGGGGTCAGCGGCGGCTCAGAAGCAGGTGACGGACAAGGTG
TCGGGCGAGAAGCCGACGTCGAAAGTACTCGACGCACCGGGTTCGGCCACGACGGAGAAGCCGACGAAGCCTTTG
GGCATCAAGGGTCGGCCGTTTGCTGTGTCGACGACGACGACGACGACGACGACGACGCGAATTCGCTATATCGTG
GTGCCGGCCAATCTGACGACGGCGAAGACGACGGCGACTAAGCCGACGAAGGCTGCGACTACGACTACGACTAAG
ACCAAGATTGGCAACTTGACGGGGATGACGAGAGCACCGACCGTGTGGAAGCCGTCCAAGGTGACGGAGACGTCC
AAGGTCGCCGAGCCTTCCCAGAGCGTCAAGCCGAAGGGGACGATTTGGAAGCGAGCTGTGGTCGACGGTGAGGGA
GAGAGCAACAATGAACAGTCCAGGTCTGTCCGTATCAACACCAATAACGATGAGGAGAGCAGCAGCAACAGCAAC
AGCAACAGCAACAGCAACAGTAACAGCAACAGTAACAGCAACAGCAACAGCAACAGCAACAGCAACGACCAGCAG
TTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCAACCAGATCCGGGAGAACCTCTTGCTCGCCCAGCAGCAG
CAGCAGCAGTTGGACAACAGGAACAGCAACAACGATAACAACACCAACAAAAAGATTGACAACGACAGGAACCGA
GTCATCGTGCTCGAGCGCGGCGGCCGAGGCGACGGTCCCGGTCCCGGCCGCGGCCACGGCCACGGCCCCATCGTC
CACAGCGGCAACTGCCGCGGCTGCCGCGACAACGACCGCTGCCAGGGAGGCCACTGCCACGGGCGGTCCAACTGC
CACGAGCGCTGCCGCAAGTACATCGTCGCCCACGGACACCACCACCACCACGACGGACACGTCCACCGCGGACAC
TTCCGCGAGCATCGCTTCCGAGGACAGCGTCAGTGCCGCGAAAAGGGGTGCGAGAAGAGGAAGGAGTGCAAGGAC
AAGGAGTGCAAGAAGGAGGTCAAGGAGGTCAAGCCCGCGCCCGCTCCGGCCGCTCCTTCGGCTTCGGTTGCGCCC
GCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCGGCTGTGCCCGCTCCGGCTGCGCCGTGT
GTGGCTGTGCCGTGTGTCCTTGCTCCGGCGCCTCCCGCTGCTGCCCCGGCGCCTCCCGCTGCTGCCCCGGCCCCT
CCGGCTGAGAACCAGCCTGCCCCGGCTGCGCCTGCTCCCGCTCCCCCGGCCGCAGCGCCCGCTCCCCCGGCCGCA
GCTCCTGCTCCCCCGGCCGCGGCTCCCGCACCCCCAGCTGCGGCTCCCGCTCCTCCGGCTGCGGCTCCGGCTCCC
CCTGCCGAAGCGGCTCCGGCTCCCCCGGCCGAAGCAGCTCCGGCTCCAGCTCCGGGCTCGGGTGGTGGCTCGCCT
CCCGCGGGATCGGCCCCTTCGCCAGGCTCGGGCACGCAGCCCTCTTCGCCTGCGGAGTCGGGACCGGCGCCCGGA
TCGAGCTCGCCCCCGGCGACGTACCAGCCGCCGTCGTCGCCTCCTGCGACGGTGATCAACGGCGCGTCGATGATG
ACGACGGGTTCCGGCCTGGCCGTCGCCGTTGCCGTTGCCGTCGTGGCCAACCTGTTCGTCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail