Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4038
Gene name
Locationscaffold_315:18539..20255
Strand+
Gene length (bp)1716
Transcript length (bp)1716
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 365 523 7.0E-06
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 358 486 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 548 570 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4038
MQTKAIALLALMGSAAAQKQVTDKVSGEKPTSKVLDAPGSATTEKPTKPLGIKGRPFAVSTTTTTTTTTRIRYIV
VPANLTTAKTTATKPTKAATTTTTKTKIGNLTGMTRAPTVWKPSKVTETSKVAEPSQSVKPKGTIWKRAVVDGEG
ESNNEQSRSVRINTNNDEESSSNSNSNSNSNSNSNSNSNSNSNSNSNDQQLQQQQQQQQQQLNQIRENLLLAQQQ
QQQLDNRNSNNDNNTNKKIDNDRNRVIVLERGGRGDGPGPGRGHGHGPIVHSGNCRGCRDNDRCQGGHCHGRSNC
HERCRKYIVAHGHHHHHDGHVHRGHFREHRFRGQRQCREKGCEKRKECKDKECKKEVKEVKPAPAPAAPSASVAP
APAPAPAPAPAPAPAPAVPAPAAPCVAVPCVLAPAPPAAAPAPPAAAPAPPAENQPAPAAPAPAPPAAAPAPPAA
APAPPAAAPAPPAAAPAPPAAAPAPPAEAAPAPPAEAAPAPAPGSGGGSPPAGSAPSPGSGTQPSSPAESGPAPG
SSSPPATYQPPSSPPATVINGASMMTTGSGLAVAVAVAVVANLFVL
Coding >Ophio5|4038
ATGCAAACCAAGGCGATTGCCTTGCTGGCCCTGATGGGGTCAGCGGCGGCTCAGAAGCAGGTGACGGACAAGGTG
TCGGGCGAGAAGCCGACGTCGAAAGTACTCGACGCACCGGGTTCGGCCACGACGGAGAAGCCGACGAAGCCTTTG
GGCATCAAGGGTCGGCCGTTTGCTGTGTCGACGACGACGACGACGACGACGACGACGCGAATTCGCTATATCGTG
GTGCCGGCCAATCTGACGACGGCGAAGACGACGGCGACTAAGCCGACGAAGGCTGCGACTACGACTACGACTAAG
ACCAAGATTGGCAACTTGACGGGGATGACGAGAGCACCGACCGTGTGGAAGCCGTCCAAGGTGACGGAGACGTCC
AAGGTCGCCGAGCCTTCCCAGAGCGTCAAGCCGAAGGGGACGATTTGGAAGCGAGCTGTGGTCGACGGTGAGGGA
GAGAGCAACAATGAACAGTCCAGGTCTGTCCGTATCAACACCAATAACGATGAGGAGAGCAGCAGCAACAGCAAC
AGCAACAGCAACAGCAACAGTAACAGCAACAGTAACAGCAACAGCAACAGCAACAGCAACAGCAACGACCAGCAG
TTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCAACCAGATCCGGGAGAACCTCTTGCTCGCCCAGCAGCAG
CAGCAGCAGTTGGACAACAGGAACAGCAACAACGATAACAACACCAACAAAAAGATTGACAACGACAGGAACCGA
GTCATCGTGCTCGAGCGCGGCGGCCGAGGCGACGGTCCCGGTCCCGGCCGCGGCCACGGCCACGGCCCCATCGTC
CACAGCGGCAACTGCCGCGGCTGCCGCGACAACGACCGCTGCCAGGGAGGCCACTGCCACGGGCGGTCCAACTGC
CACGAGCGCTGCCGCAAGTACATCGTCGCCCACGGACACCACCACCACCACGACGGACACGTCCACCGCGGACAC
TTCCGCGAGCATCGCTTCCGAGGACAGCGTCAGTGCCGCGAAAAGGGGTGCGAGAAGAGGAAGGAGTGCAAGGAC
AAGGAGTGCAAGAAGGAGGTCAAGGAGGTCAAGCCCGCGCCCGCTCCGGCCGCTCCTTCGGCTTCGGTTGCGCCC
GCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCGGCTGTGCCCGCTCCGGCTGCGCCGTGT
GTGGCTGTGCCGTGTGTCCTTGCTCCGGCGCCTCCCGCTGCTGCCCCGGCGCCTCCCGCTGCTGCCCCGGCCCCT
CCGGCTGAGAACCAGCCTGCCCCGGCTGCGCCTGCTCCCGCTCCCCCGGCCGCAGCGCCCGCTCCCCCGGCCGCA
GCTCCTGCTCCCCCGGCCGCGGCTCCCGCACCCCCAGCTGCGGCTCCCGCTCCTCCGGCTGCGGCTCCGGCTCCC
CCTGCCGAAGCGGCTCCGGCTCCCCCGGCCGAAGCAGCTCCGGCTCCAGCTCCGGGCTCGGGTGGTGGCTCGCCT
CCCGCGGGATCGGCCCCTTCGCCAGGCTCGGGCACGCAGCCCTCTTCGCCTGCGGAGTCGGGACCGGCGCCCGGA
TCGAGCTCGCCCCCGGCGACGTACCAGCCGCCGTCGTCGCCTCCTGCGACGGTGATCAACGGCGCGTCGATGATG
ACGACGGGTTCCGGCCTGGCCGTCGCCGTTGCCGTTGCCGTCGTGGCCAACCTGTTCGTCCTG
Transcript >Ophio5|4038
ATGCAAACCAAGGCGATTGCCTTGCTGGCCCTGATGGGGTCAGCGGCGGCTCAGAAGCAGGTGACGGACAAGGTG
TCGGGCGAGAAGCCGACGTCGAAAGTACTCGACGCACCGGGTTCGGCCACGACGGAGAAGCCGACGAAGCCTTTG
GGCATCAAGGGTCGGCCGTTTGCTGTGTCGACGACGACGACGACGACGACGACGACGCGAATTCGCTATATCGTG
GTGCCGGCCAATCTGACGACGGCGAAGACGACGGCGACTAAGCCGACGAAGGCTGCGACTACGACTACGACTAAG
ACCAAGATTGGCAACTTGACGGGGATGACGAGAGCACCGACCGTGTGGAAGCCGTCCAAGGTGACGGAGACGTCC
AAGGTCGCCGAGCCTTCCCAGAGCGTCAAGCCGAAGGGGACGATTTGGAAGCGAGCTGTGGTCGACGGTGAGGGA
GAGAGCAACAATGAACAGTCCAGGTCTGTCCGTATCAACACCAATAACGATGAGGAGAGCAGCAGCAACAGCAAC
AGCAACAGCAACAGCAACAGTAACAGCAACAGTAACAGCAACAGCAACAGCAACAGCAACAGCAACGACCAGCAG
TTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCAACCAGATCCGGGAGAACCTCTTGCTCGCCCAGCAGCAG
CAGCAGCAGTTGGACAACAGGAACAGCAACAACGATAACAACACCAACAAAAAGATTGACAACGACAGGAACCGA
GTCATCGTGCTCGAGCGCGGCGGCCGAGGCGACGGTCCCGGTCCCGGCCGCGGCCACGGCCACGGCCCCATCGTC
CACAGCGGCAACTGCCGCGGCTGCCGCGACAACGACCGCTGCCAGGGAGGCCACTGCCACGGGCGGTCCAACTGC
CACGAGCGCTGCCGCAAGTACATCGTCGCCCACGGACACCACCACCACCACGACGGACACGTCCACCGCGGACAC
TTCCGCGAGCATCGCTTCCGAGGACAGCGTCAGTGCCGCGAAAAGGGGTGCGAGAAGAGGAAGGAGTGCAAGGAC
AAGGAGTGCAAGAAGGAGGTCAAGGAGGTCAAGCCCGCGCCCGCTCCGGCCGCTCCTTCGGCTTCGGTTGCGCCC
GCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCGGCTGTGCCCGCTCCGGCTGCGCCGTGT
GTGGCTGTGCCGTGTGTCCTTGCTCCGGCGCCTCCCGCTGCTGCCCCGGCGCCTCCCGCTGCTGCCCCGGCCCCT
CCGGCTGAGAACCAGCCTGCCCCGGCTGCGCCTGCTCCCGCTCCCCCGGCCGCAGCGCCCGCTCCCCCGGCCGCA
GCTCCTGCTCCCCCGGCCGCGGCTCCCGCACCCCCAGCTGCGGCTCCCGCTCCTCCGGCTGCGGCTCCGGCTCCC
CCTGCCGAAGCGGCTCCGGCTCCCCCGGCCGAAGCAGCTCCGGCTCCAGCTCCGGGCTCGGGTGGTGGCTCGCCT
CCCGCGGGATCGGCCCCTTCGCCAGGCTCGGGCACGCAGCCCTCTTCGCCTGCGGAGTCGGGACCGGCGCCCGGA
TCGAGCTCGCCCCCGGCGACGTACCAGCCGCCGTCGTCGCCTCCTGCGACGGTGATCAACGGCGCGTCGATGATG
ACGACGGGTTCCGGCCTGGCCGTCGCCGTTGCCGTTGCCGTCGTGGCCAACCTGTTCGTCCTGTGA
Gene >Ophio5|4038
ATGCAAACCAAGGCGATTGCCTTGCTGGCCCTGATGGGGTCAGCGGCGGCTCAGAAGCAGGTGACGGACAAGGTG
TCGGGCGAGAAGCCGACGTCGAAAGTACTCGACGCACCGGGTTCGGCCACGACGGAGAAGCCGACGAAGCCTTTG
GGCATCAAGGGTCGGCCGTTTGCTGTGTCGACGACGACGACGACGACGACGACGACGCGAATTCGCTATATCGTG
GTGCCGGCCAATCTGACGACGGCGAAGACGACGGCGACTAAGCCGACGAAGGCTGCGACTACGACTACGACTAAG
ACCAAGATTGGCAACTTGACGGGGATGACGAGAGCACCGACCGTGTGGAAGCCGTCCAAGGTGACGGAGACGTCC
AAGGTCGCCGAGCCTTCCCAGAGCGTCAAGCCGAAGGGGACGATTTGGAAGCGAGCTGTGGTCGACGGTGAGGGA
GAGAGCAACAATGAACAGTCCAGGTCTGTCCGTATCAACACCAATAACGATGAGGAGAGCAGCAGCAACAGCAAC
AGCAACAGCAACAGCAACAGTAACAGCAACAGTAACAGCAACAGCAACAGCAACAGCAACAGCAACGACCAGCAG
TTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCTCAACCAGATCCGGGAGAACCTCTTGCTCGCCCAGCAGCAG
CAGCAGCAGTTGGACAACAGGAACAGCAACAACGATAACAACACCAACAAAAAGATTGACAACGACAGGAACCGA
GTCATCGTGCTCGAGCGCGGCGGCCGAGGCGACGGTCCCGGTCCCGGCCGCGGCCACGGCCACGGCCCCATCGTC
CACAGCGGCAACTGCCGCGGCTGCCGCGACAACGACCGCTGCCAGGGAGGCCACTGCCACGGGCGGTCCAACTGC
CACGAGCGCTGCCGCAAGTACATCGTCGCCCACGGACACCACCACCACCACGACGGACACGTCCACCGCGGACAC
TTCCGCGAGCATCGCTTCCGAGGACAGCGTCAGTGCCGCGAAAAGGGGTGCGAGAAGAGGAAGGAGTGCAAGGAC
AAGGAGTGCAAGAAGGAGGTCAAGGAGGTCAAGCCCGCGCCCGCTCCGGCCGCTCCTTCGGCTTCGGTTGCGCCC
GCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCCGCTCCGGCTGTGCCCGCTCCGGCTGCGCCGTGT
GTGGCTGTGCCGTGTGTCCTTGCTCCGGCGCCTCCCGCTGCTGCCCCGGCGCCTCCCGCTGCTGCCCCGGCCCCT
CCGGCTGAGAACCAGCCTGCCCCGGCTGCGCCTGCTCCCGCTCCCCCGGCCGCAGCGCCCGCTCCCCCGGCCGCA
GCTCCTGCTCCCCCGGCCGCGGCTCCCGCACCCCCAGCTGCGGCTCCCGCTCCTCCGGCTGCGGCTCCGGCTCCC
CCTGCCGAAGCGGCTCCGGCTCCCCCGGCCGAAGCAGCTCCGGCTCCAGCTCCGGGCTCGGGTGGTGGCTCGCCT
CCCGCGGGATCGGCCCCTTCGCCAGGCTCGGGCACGCAGCCCTCTTCGCCTGCGGAGTCGGGACCGGCGCCCGGA
TCGAGCTCGCCCCCGGCGACGTACCAGCCGCCGTCGTCGCCTCCTGCGACGGTGATCAACGGCGCGTCGATGATG
ACGACGGGTTCCGGCCTGGCCGTCGCCGTTGCCGTTGCCGTCGTGGCCAACCTGTTCGTCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail