Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4036
Gene name
Locationscaffold_315:13724..15472
Strand+
Gene length (bp)1748
Transcript length (bp)1551
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 111 133 22
3 153 175 22
4 184 206 22
5 221 240 19
6 291 313 22
7 318 340 22
8 369 391 22
9 411 433 22
10 440 462 22
11 477 499 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 25.22 12.39 38.06
CcL In ants, during behavior modification 22.44 10.69 34.19
CcD In ants, recently dead 24.44 11.93 36.96

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.702848 no
SC16a CcD 0.920233 no
CcL CcD 0.778904 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4036
MSALQGLEAATSIITRDLPIASANVSTPTSFQWRRDRYPVALSFNMAAFLLPALYSTLTKLWVAKMDSSMVVTTD
VYTYMATIAEVINDGLPRASWTTIGDKHSRKRSQRLALTHTLLLAQAFLGLVLSLVLLGAAEAFARGFVPREVRQ
QSITYVRIGSFSVFSGAIEAAIGAATRALDEPDVALVLSCIKFAVNIILDLLLISTLKVGSFEPTANLQAGIHLT
CNLAATFGALAYFLIKNSDQHKGQERDQERDQERGRERVAPSLWALKVLLWPAIPTFAESAIRNSLYLWLVTTIV
SMGTIYATAWGVFNTIRWGFVMVPVSALEATTLAFVGHNWSRWRSNIGITTLQPRPSLASLVRIARPAFVSAVLA
LAFEVPLCISMYLVGARSFARYLSGSDDVAEVTAHMWRTLDWCYIVFAVSTQMSAILLATRPKWYLWQSLASTLL
YVLPWTIVCQVAKLDRNSAWTYHALTFGGSLVFSFICIMAVLGLWAWTLRTGRAHLERVRLPPDSA
Coding >Ophio5|4036
ATGTCAGCGCTTCAGGGCCTTGAGGCTGCAACTTCCATCATCACAAGGGACCTCCCTATCGCCAGTGCCAACGTG
AGCACCCCGACGTCGTTCCAATGGCGAAGGGACAGATACCCAGTGGCCCTATCCTTCAACATGGCTGCCTTTCTG
CTTCCAGCCCTGTACAGTACCCTGACCAAGCTTTGGGTTGCCAAGATGGACTCCAGCATGGTCGTCACGACAGAC
GTCTACACGTACATGGCCACCATCGCCGAGGTCATCAACGATGGTCTCCCCCGCGCTTCGTGGACCACGATTGGT
GACAAGCACTCACGCAAACGCAGTCAACGTCTGGCCTTGACCCATACTCTCTTACTTGCCCAGGCCTTTCTAGGG
CTCGTCCTTTCCCTCGTATTGCTCGGCGCCGCGGAGGCTTTCGCCAGGGGATTCGTGCCTCGCGAGGTGCGCCAG
CAGAGCATCACTTACGTCCGTATCGGCAGCTTCTCCGTCTTCAGTGGTGCCATCGAGGCTGCCATTGGCGCTGCG
ACGAGGGCCCTCGACGAACCCGACGTCGCCCTGGTCTTGAGTTGTATCAAGTTTGCCGTAAATATTATCCTCGAC
TTGCTGCTGATCTCAACCTTGAAAGTTGGGAGCTTCGAGCCGACGGCGAATTTACAGGCAGGCATCCATCTGACC
TGCAACCTCGCAGCCACTTTTGGCGCCCTTGCTTACTTTTTGATTAAAAATTCGGACCAGCACAAGGGCCAGGAA
AGGGACCAGGAAAGGGACCAGGAAAGGGGCAGAGAGCGTGTGGCCCCCAGTCTCTGGGCCCTCAAGGTCCTCCTT
TGGCCGGCCATTCCAACCTTTGCCGAGTCGGCCATACGGAACTCCTTGTATCTGTGGCTCGTCACCACCATCGTC
TCCATGGGAACCATCTACGCCACGGCTTGGGGCGTCTTCAACACAATCCGCTGGGGCTTCGTCATGGTCCCCGTG
TCCGCCTTGGAAGCCACGACCCTGGCCTTTGTAGGACACAATTGGAGCCGCTGGCGAAGCAATATTGGCATCACC
ACGCTCCAGCCCCGGCCGAGTCTGGCGTCTTTGGTTCGAATCGCCCGTCCGGCATTCGTCTCCGCCGTCCTGGCC
CTCGCCTTCGAAGTGCCGCTTTGCATTTCCATGTATCTTGTGGGTGCACGCTCCTTTGCGCGGTATCTAAGCGGC
AGCGATGATGTGGCTGAAGTGACGGCCCATATGTGGAGAACGTTGGACTGGTGCTATATCGTCTTCGCCGTATCG
ACGCAAATGAGTGCCATCTTACTCGCGACGCGACCAAAGTGGTATCTGTGGCAGAGCTTGGCCAGCACGCTTTTA
TACGTCCTGCCTTGGACCATCGTCTGTCAGGTGGCCAAGCTGGATCGGAACAGTGCCTGGACGTACCACGCGCTG
ACCTTTGGAGGGAGTCTGGTGTTTAGCTTCATCTGCATAATGGCTGTCCTAGGACTATGGGCGTGGACTTTGCGG
ACGGGGAGGGCGCACTTGGAGCGGGTCAGACTCCCGCCCGACAGTGCT
Transcript >Ophio5|4036
ATGTCAGCGCTTCAGGGCCTTGAGGCTGCAACTTCCATCATCACAAGGGACCTCCCTATCGCCAGTGCCAACGTG
AGCACCCCGACGTCGTTCCAATGGCGAAGGGACAGATACCCAGTGGCCCTATCCTTCAACATGGCTGCCTTTCTG
CTTCCAGCCCTGTACAGTACCCTGACCAAGCTTTGGGTTGCCAAGATGGACTCCAGCATGGTCGTCACGACAGAC
GTCTACACGTACATGGCCACCATCGCCGAGGTCATCAACGATGGTCTCCCCCGCGCTTCGTGGACCACGATTGGT
GACAAGCACTCACGCAAACGCAGTCAACGTCTGGCCTTGACCCATACTCTCTTACTTGCCCAGGCCTTTCTAGGG
CTCGTCCTTTCCCTCGTATTGCTCGGCGCCGCGGAGGCTTTCGCCAGGGGATTCGTGCCTCGCGAGGTGCGCCAG
CAGAGCATCACTTACGTCCGTATCGGCAGCTTCTCCGTCTTCAGTGGTGCCATCGAGGCTGCCATTGGCGCTGCG
ACGAGGGCCCTCGACGAACCCGACGTCGCCCTGGTCTTGAGTTGTATCAAGTTTGCCGTAAATATTATCCTCGAC
TTGCTGCTGATCTCAACCTTGAAAGTTGGGAGCTTCGAGCCGACGGCGAATTTACAGGCAGGCATCCATCTGACC
TGCAACCTCGCAGCCACTTTTGGCGCCCTTGCTTACTTTTTGATTAAAAATTCGGACCAGCACAAGGGCCAGGAA
AGGGACCAGGAAAGGGACCAGGAAAGGGGCAGAGAGCGTGTGGCCCCCAGTCTCTGGGCCCTCAAGGTCCTCCTT
TGGCCGGCCATTCCAACCTTTGCCGAGTCGGCCATACGGAACTCCTTGTATCTGTGGCTCGTCACCACCATCGTC
TCCATGGGAACCATCTACGCCACGGCTTGGGGCGTCTTCAACACAATCCGCTGGGGCTTCGTCATGGTCCCCGTG
TCCGCCTTGGAAGCCACGACCCTGGCCTTTGTAGGACACAATTGGAGCCGCTGGCGAAGCAATATTGGCATCACC
ACGCTCCAGCCCCGGCCGAGTCTGGCGTCTTTGGTTCGAATCGCCCGTCCGGCATTCGTCTCCGCCGTCCTGGCC
CTCGCCTTCGAAGTGCCGCTTTGCATTTCCATGTATCTTGTGGGTGCACGCTCCTTTGCGCGGTATCTAAGCGGC
AGCGATGATGTGGCTGAAGTGACGGCCCATATGTGGAGAACGTTGGACTGGTGCTATATCGTCTTCGCCGTATCG
ACGCAAATGAGTGCCATCTTACTCGCGACGCGACCAAAGTGGTATCTGTGGCAGAGCTTGGCCAGCACGCTTTTA
TACGTCCTGCCTTGGACCATCGTCTGTCAGGTGGCCAAGCTGGATCGGAACAGTGCCTGGACGTACCACGCGCTG
ACCTTTGGAGGGAGTCTGGTGTTTAGCTTCATCTGCATAATGGCTGTCCTAGGACTATGGGCGTGGACTTTGCGG
ACGGGGAGGGCGCACTTGGAGCGGGTCAGACTCCCGCCCGACAGTGCTTGA
Gene >Ophio5|4036
ATGTCGTACAGGCCGGCAGCGGCCTCCTCTTGGCCAGAGGAGAGCGCTTCAGGGCCTTGAGGCTGCAACTTCCAT
CATCACAAGGGTCGAATCCTCCCTTTCCCAGCCCTCGTTCCCCATGTATAGAGCGCCGTCGACTGAGAGGCAGGC
GCAGGACCTCCCTATCGCCAGTGCCAACGTGAGCACCCCGACGTCGTTCCAATGGCGAAGGGACAGATACCCAGT
GGCCCTATCCTTCAACATGGCTGCCTTTCTGCTTCCAGCCCTGTACAGTACCCTGACCAAGCTTTGGGTTGCCAA
GATGGACTCCAGCATGGTCGTCACGACAGAGTCAGCAGCATTTTCATCTTGTACCTACTCACCAACAAATACCCG
ACTCCCTTCGGCAACTGACATGCTCAATCCTCCCCCCCCCCTCCAGCGTCTACACGTACATGGCCACCATCGCCG
AGGTCATCAACGATGGTCTCCCCCGCGCTTCGTGGACCACGATTGGTGACAAGCACTCACGCAAACGCAGTCAAC
GTCTGGCCTTGACCCATACTCTCTTACTTGCCCAGGCCTTTCTAGGGCTCGTCCTTTCCCTCGTATTGCTCGGCG
CCGCGGAGGCTTTCGCCAGGGGATTCGTGCCTCGCGAGGTGCGCCAGCAGAGCATCACTTACGTCCGTATCGGCA
GCTTCTCCGTCTTCAGTGGTGCCATCGAGGCTGCCATTGGCGCTGCGACGAGGGCCCTCGACGAACCCGACGTCG
CCCTGGTCTTGAGTTGTATCAAGTTTGCCGTAAATATTATCCTCGACTTGCTGCTGATCTCAACCTTGAAAGTTG
GGAGCTTCGAGCCGACGGCGAATTTACAGGCAGGCATCCATCTGACCTGCAACCTCGCAGCCACTTTTGGCGCCC
TTGCTTACTTTTTGATTAAAAATTCGGACCAGCACAAGGGCCAGGAAAGGGACCAGGAAAGGGACCAGGAAAGGG
GCAGAGAGCGTGTGGCCCCCAGTCTCTGGGCCCTCAAGGTCCTCCTTTGGCCGGCCATTCCAACCTTTGCCGAGT
CGGCCATACGGAACTCCTTGTATCTGTGGCTCGTCACCACCATCGTCTCCATGGGAACCATCTACGCCACGGCTT
GGGGCGTCTTCAACACAATCCGCTGGGGCTTCGTCATGGTCCCCGTGTCCGCCTTGGAAGCCACGACCCTGGCCT
TTGTAGGACACAATTGGAGCCGCTGGCGAAGCAATATTGGCATCACCACGCTCCAGCCCCGGCCGAGTCTGGCGT
CTTTGGTTCGAATCGCCCGTCCGGCATTCGTCTCCGCCGTCCTGGCCCTCGCCTTCGAAGTGCCGCTTTGCATTT
CCATGTATCTTGTGGGTGCACGCTCCTTTGCGCGGTATCTAAGCGGCAGCGATGATGTGGCTGAAGTGACGGCCC
ATATGTGGAGAACGTTGGACTGGTGCTATATCGTCTTCGCCGTATCGACGCAAATGAGTGCCATCTTACTCGCGA
CGCGACCAAAGTGGTATCTGTGGCAGAGCTTGGCCAGCACGCTTTTATACGTCCTGCCTTGGACCATCGTCTGTC
AGGTGGCCAAGCTGGATCGGAACAGTGCCTGGACGTACCACGCGCTGACCTTTGGAGGGAGTCTGGTGTTTAGCT
TCATCTGCATAATGGCTGTCCTAGGACTATGGGCGTGGACTTTGCGGACGGGGAGGGCGCACTTGGAGCGGGTCA
GACTCCCGCCCGACAGTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail