Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4032
Gene name
Locationscaffold_315:4383..5439
Strand-
Gene length (bp)1056
Transcript length (bp)900
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08559 Cut8 Cut8, nuclear proteasome tether protein 1.4E-70 36 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9ES90|STS1_METRA Tethering factor for nuclear proteasome STS1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=STS1 PE=3 SV=1 1 299 2.0E-161
sp|C7YRR5|STS1_NECH7 Tethering factor for nuclear proteasome STS1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=STS1 PE=3 SV=1 1 293 1.0E-143
sp|A4QYI9|STS1_MAGO7 Tethering factor for nuclear proteasome STS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=STS1 PE=3 SV=1 1 299 1.0E-132
sp|E3QDN5|STS1_COLGM Tethering factor for nuclear proteasome STS1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=STS1 PE=3 SV=1 1 299 3.0E-131
sp|Q9C224|STS1_NEUCR Tethering factor for nuclear proteasome sts1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sts1 PE=3 SV=1 1 299 2.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9ES90|STS1_METRA Tethering factor for nuclear proteasome STS1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=STS1 PE=3 SV=1 1 299 2.0E-161
sp|C7YRR5|STS1_NECH7 Tethering factor for nuclear proteasome STS1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=STS1 PE=3 SV=1 1 293 1.0E-143
sp|A4QYI9|STS1_MAGO7 Tethering factor for nuclear proteasome STS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=STS1 PE=3 SV=1 1 299 1.0E-132
sp|E3QDN5|STS1_COLGM Tethering factor for nuclear proteasome STS1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=STS1 PE=3 SV=1 1 299 3.0E-131
sp|Q9C224|STS1_NEUCR Tethering factor for nuclear proteasome sts1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sts1 PE=3 SV=1 1 299 2.0E-120
sp|D1ZMW1|STS1_SORMK Tethering factor for nuclear proteasome STS1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=STS1 PE=3 SV=1 1 299 1.0E-118
sp|B2B7W0|STS1_PODAN Tethering factor for nuclear proteasome STS1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=STS1 PE=3 SV=1 26 299 9.0E-108
sp|A7EZ71|STS1_SCLS1 Tethering factor for nuclear proteasome sts1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sts1 PE=3 SV=1 1 299 3.0E-105
sp|C6H861|STS1_AJECH Tethering factor for nuclear proteasome STS1 OS=Ajellomyces capsulatus (strain H143) GN=STS1 PE=3 SV=1 1 299 5.0E-91
sp|C0NIT8|STS1_AJECG Tethering factor for nuclear proteasome STS1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=STS1 PE=3 SV=1 1 299 5.0E-91
sp|C5JJ91|STS1_AJEDS Tethering factor for nuclear proteasome STS1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=STS1 PE=3 SV=1 1 299 2.0E-89
sp|C5GE44|STS1_AJEDR Tethering factor for nuclear proteasome STS1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=STS1 PE=3 SV=1 1 299 2.0E-89
sp|A6R7I3|STS1_AJECN Tethering factor for nuclear proteasome STS1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=STS1 PE=3 SV=1 1 299 2.0E-89
sp|B6Q1K5|STS1_TALMQ Tethering factor for nuclear proteasome sts1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sts1 PE=3 SV=1 1 299 6.0E-87
sp|B8LTU5|STS1_TALSN Tethering factor for nuclear proteasome sts1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sts1 PE=3 SV=1 1 299 8.0E-87
sp|A1CH27|STS1_ASPCL Tethering factor for nuclear proteasome sts1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sts1 PE=3 SV=1 1 299 7.0E-86
sp|E9D0S5|STS1_COCPS Tethering factor for nuclear proteasome STS1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=STS1 PE=3 SV=1 1 299 1.0E-85
sp|C5P8M7|STS1_COCP7 Tethering factor for nuclear proteasome STS1 OS=Coccidioides posadasii (strain C735) GN=STS1 PE=3 SV=1 1 299 1.0E-85
sp|B6HUK8|STS1_PENRW Tethering factor for nuclear proteasome sts1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sts1 PE=3 SV=1 1 299 3.0E-84
sp|E5R332|STS1_ARTGP Tethering factor for nuclear proteasome STS1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=STS1 PE=3 SV=1 1 299 2.0E-83
sp|C0SIQ6|STS1_PARBP Tethering factor for nuclear proteasome STS1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=STS1 PE=3 SV=1 1 299 2.0E-83
sp|C1GLQ3|STS1_PARBD Tethering factor for nuclear proteasome STS1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=STS1 PE=3 SV=1 1 299 2.0E-83
sp|Q2UGF7|STS1_ASPOR Tethering factor for nuclear proteasome sts1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sts1 PE=3 SV=1 1 299 2.0E-83
sp|B8N9X2|STS1_ASPFN Tethering factor for nuclear proteasome sts1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sts1 PE=3 SV=1 1 299 2.0E-83
sp|C1HAE1|STS1_PARBA Tethering factor for nuclear proteasome STS1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=STS1 PE=3 SV=1 1 299 3.0E-82
sp|Q0USL4|STS1_PHANO Tethering factor for nuclear proteasome STS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=STS1 PE=3 SV=1 18 299 6.0E-82
sp|Q5B4W9|STS1_EMENI Tethering factor for nuclear proteasome sts1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sts1 PE=3 SV=1 1 299 4.0E-81
sp|A1CXR0|STS1_NEOFI Tethering factor for nuclear proteasome sts1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sts1 PE=3 SV=1 1 299 6.0E-81
sp|E3RPB1|STS1_PYRTT Tethering factor for nuclear proteasome sts1 OS=Pyrenophora teres f. teres (strain 0-1) GN=sts1 PE=3 SV=1 1 299 8.0E-81
sp|B0Y5Q9|STS1_ASPFC Tethering factor for nuclear proteasome sts1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sts1 PE=3 SV=1 1 299 9.0E-81
sp|B2W0D9|STS1_PYRTR Tethering factor for nuclear proteasome sts1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sts1 PE=3 SV=1 1 299 1.0E-80
sp|Q4WNW3|STS1_ASPFU Tethering factor for nuclear proteasome sts1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sts1 PE=3 SV=1 1 299 1.0E-79
sp|Q0CLE0|STS1_ASPTN Tethering factor for nuclear proteasome sts1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sts1 PE=3 SV=1 1 299 2.0E-78
sp|C5FF22|STS1_ARTOC Tethering factor for nuclear proteasome STS1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=STS1 PE=3 SV=1 1 227 3.0E-50
sp|Q6CH63|STS1_YARLI Tethering factor for nuclear proteasome STS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STS1 PE=3 SV=1 66 257 1.0E-35
sp|C4YCB9|STS1_CLAL4 Tethering factor for nuclear proteasome STS1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=STS1 PE=3 SV=1 66 261 1.0E-33
sp|Q6BWL0|STS1_DEBHA Tethering factor for nuclear proteasome STS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STS1 PE=3 SV=2 20 230 5.0E-29
sp|B9W900|STS1_CANDC Tethering factor for nuclear proteasome STS1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=STS1 PE=3 SV=1 33 233 1.0E-27
sp|C4YD57|STS1_CANAW Tethering factor for nuclear proteasome STS1 OS=Candida albicans (strain WO-1) GN=STS1 PE=3 SV=1 33 233 9.0E-27
sp|Q5APB6|STS1_CANAL Tethering factor for nuclear proteasome STS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=STS1 PE=3 SV=1 33 233 9.0E-27
sp|C5MBD4|STS1_CANTT Tethering factor for nuclear proteasome STS1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=STS1 PE=3 SV=1 22 228 7.0E-26
sp|A5DEJ2|STS1_PICGU Tethering factor for nuclear proteasome STS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=STS1 PE=3 SV=2 24 294 1.0E-25
sp|A5DSS9|STS1_LODEL Tethering factor for nuclear proteasome STS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=STS1 PE=3 SV=1 65 250 2.0E-23
sp|C5DHJ9|STS1_LACTC Tethering factor for nuclear proteasome STS1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=STS1 PE=3 SV=1 26 260 6.0E-23
sp|P38937|CUT8_SCHPO Tethering factor for nuclear proteasome cut8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut8 PE=1 SV=1 36 260 1.0E-22
sp|Q6FKQ4|STS1_CANGA Tethering factor for nuclear proteasome STS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STS1 PE=3 SV=1 75 262 2.0E-18
sp|C4R591|STS1_PICPG Tethering factor for nuclear proteasome STS1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=STS1 PE=3 SV=1 37 221 1.0E-16
sp|E7RAM2|STS1_OGAPD Tethering factor for nuclear proteasome STS1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=STS1 PE=3 SV=2 36 205 5.0E-16
sp|P38637|STS1_YEAST Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STS1 PE=1 SV=1 75 253 5.0E-15
sp|C8ZAR0|STS1_YEAS8 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=STS1 PE=3 SV=1 75 253 5.0E-15
sp|B3LTJ8|STS1_YEAS1 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=STS1 PE=3 SV=1 75 253 5.0E-15
sp|E7QG80|STS1_YEASZ Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=STS1 PE=3 SV=1 75 253 6.0E-15
sp|E7LVV3|STS1_YEASV Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=STS1 PE=3 SV=1 75 253 6.0E-15
sp|E7KDX7|STS1_YEASA Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain AWRI796) GN=STS1 PE=3 SV=1 75 253 6.0E-15
sp|C7GJG1|STS1_YEAS2 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain JAY291) GN=STS1 PE=3 SV=1 75 253 7.0E-15
sp|E7KPZ3|STS1_YEASL Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=STS1 PE=3 SV=1 75 253 8.0E-15
sp|A6ZVT0|STS1_YEAS7 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=STS1 PE=3 SV=1 75 253 2.0E-14
sp|Q6CQN1|STS1_KLULA Tethering factor for nuclear proteasome STS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STS1 PE=3 SV=1 35 279 6.0E-13
sp|Q74ZG4|STS1_ASHGO Tethering factor for nuclear proteasome STS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STS1 PE=3 SV=2 62 257 2.0E-12
sp|C5DWK1|STS1_ZYGRC Tethering factor for nuclear proteasome STS1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=STS1 PE=3 SV=1 31 262 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system Yes
GO:0031144 proteasome localization Yes
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No
GO:0030163 protein catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0051179 localization No
GO:0019941 modification-dependent protein catabolic process No
GO:0009056 catabolic process No
GO:0006508 proteolysis No
GO:0044238 primary metabolic process No
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0031503 protein-containing complex localization No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0019538 protein metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0010498 proteasomal protein catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 64.23 33.35 95.11
CcL In ants, during behavior modification 92.24 49.47 135.01
CcD In ants, recently dead 63.65 32.97 94.33

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.120610 no
SC16a CcD 0.976418 no
CcL CcD 0.106625 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4032
MNVLLSPQPPVFPHQRENYRLSPQRSVSPLHGMAPRKRKADADGDETMSPLSSPAAAARPLARPAKRSRINETFG
RSLTPHRLLETLDAGQLRVVLERICEQHPQIGQEVIAGAPRPSVSCALDVLQGYHDKLKTAFPYGQSSPDYTYHR
IKEPMVALTEALSDFTLQFLPPTESQPTRSLRYLDGATKLVHQLPDWDSQAYRHHKDGAYEDLSRAWALVINEAG
KRGGGINLHSGGWDETLSRHNEQSGGRLGLAMSAMGSNVGWMASNQPAFPVEQSSILNQLISGAYGSAVRVGPW
Coding >Ophio5|4032
ATGAACGTGTTGCTTTCGCCGCAGCCGCCTGTCTTTCCTCATCAACGCGAAAATTACCGCCTTTCGCCTCAACGA
TCAGTATCTCCACTGCACGGCATGGCACCGCGAAAACGGAAAGCAGACGCCGATGGCGACGAGACCATGTCACCT
TTGAGCTCCCCCGCTGCTGCCGCGAGGCCACTCGCCCGACCGGCCAAAAGATCGAGAATTAATGAGACCTTTGGC
CGGTCGCTGACTCCCCATCGATTGCTCGAGACTCTCGATGCCGGCCAATTGCGCGTCGTCCTGGAACGCATCTGC
GAACAACATCCACAGATCGGCCAGGAAGTCATCGCCGGCGCCCCGCGTCCTTCCGTTTCATGCGCCCTCGACGTC
TTGCAAGGCTACCACGACAAGCTCAAGACGGCTTTTCCTTACGGCCAGTCGAGCCCTGACTACACCTACCACCGC
ATTAAGGAGCCCATGGTCGCCCTCACCGAAGCCCTTTCCGACTTTACGCTCCAATTTCTCCCGCCCACCGAAAGC
CAGCCCACCAGGTCGCTGCGGTACCTCGATGGTGCCACCAAGCTCGTCCATCAGCTGCCAGACTGGGACTCGCAA
GCATATCGCCACCACAAAGACGGCGCTTACGAAGACTTGTCAAGGGCATGGGCCCTGGTCATCAACGAGGCTGGC
AAGAGAGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACGAGACGCTGTCACGACACAACGAGCAGTCGGGA
GGACGGCTGGGGCTGGCCATGTCGGCCATGGGCAGCAACGTCGGCTGGATGGCCTCGAACCAGCCGGCGTTCCCC
GTCGAGCAGTCGTCGATTCTCAACCAGCTAATATCCGGAGCTTACGGGTCGGCCGTGCGGGTAGGACCCTGG
Transcript >Ophio5|4032
ATGAACGTGTTGCTTTCGCCGCAGCCGCCTGTCTTTCCTCATCAACGCGAAAATTACCGCCTTTCGCCTCAACGA
TCAGTATCTCCACTGCACGGCATGGCACCGCGAAAACGGAAAGCAGACGCCGATGGCGACGAGACCATGTCACCT
TTGAGCTCCCCCGCTGCTGCCGCGAGGCCACTCGCCCGACCGGCCAAAAGATCGAGAATTAATGAGACCTTTGGC
CGGTCGCTGACTCCCCATCGATTGCTCGAGACTCTCGATGCCGGCCAATTGCGCGTCGTCCTGGAACGCATCTGC
GAACAACATCCACAGATCGGCCAGGAAGTCATCGCCGGCGCCCCGCGTCCTTCCGTTTCATGCGCCCTCGACGTC
TTGCAAGGCTACCACGACAAGCTCAAGACGGCTTTTCCTTACGGCCAGTCGAGCCCTGACTACACCTACCACCGC
ATTAAGGAGCCCATGGTCGCCCTCACCGAAGCCCTTTCCGACTTTACGCTCCAATTTCTCCCGCCCACCGAAAGC
CAGCCCACCAGGTCGCTGCGGTACCTCGATGGTGCCACCAAGCTCGTCCATCAGCTGCCAGACTGGGACTCGCAA
GCATATCGCCACCACAAAGACGGCGCTTACGAAGACTTGTCAAGGGCATGGGCCCTGGTCATCAACGAGGCTGGC
AAGAGAGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACGAGACGCTGTCACGACACAACGAGCAGTCGGGA
GGACGGCTGGGGCTGGCCATGTCGGCCATGGGCAGCAACGTCGGCTGGATGGCCTCGAACCAGCCGGCGTTCCCC
GTCGAGCAGTCGTCGATTCTCAACCAGCTAATATCCGGAGCTTACGGGTCGGCCGTGCGGGTAGGACCCTGGTAG
Gene >Ophio5|4032
ATGAACGTGTTGCTTTCGCCGCAGCCGCCTGTCTTTCCTCATCAACGCGAAAATTACCGCCTTTCGCCTCAACGA
TCAGGTACCTTGTCCCCCTCCCTGCCAGGCTTCCTGCATGCGTAATTGGCCGGGTCCACCGCCTCAACATGTCCA
AAACAAAGGCCGCGCATGCCACACCACCACTTTCTTCGTCTCGTCTCCTTTTCTCATGACGCTAATTGCACAAAC
ATAACTTCAGTATCTCCACTGCACGGCATGGCACCGCGAAAACGGAAAGCAGACGCCGATGGCGACGAGACCATG
TCACCTTTGAGCTCCCCCGCTGCTGCCGCGAGGCCACTCGCCCGACCGGCCAAAAGATCGAGAATTAATGAGACC
TTTGGCCGGTCGCTGACTCCCCATCGATTGCTCGAGACTCTCGATGCCGGCCAATTGCGCGTCGTCCTGGAACGC
ATCTGCGAACAACATCCACAGATCGGCCAGGAAGTCATCGCCGGCGCCCCGCGTCCTTCCGTTTCATGCGCCCTC
GACGTCTTGCAAGGCTACCACGACAAGCTCAAGACGGCTTTTCCTTACGGCCAGTCGAGCCCTGACTACACCTAC
CACCGCATTAAGGAGCCCATGGTCGCCCTCACCGAAGCCCTTTCCGACTTTACGCTCCAATTTCTCCCGCCCACC
GAAAGCCAGCCCACCAGGTCGCTGCGGTACCTCGATGGTGCCACCAAGCTCGTCCATCAGCTGCCAGACTGGGAC
TCGCAAGCATATCGCCACCACAAAGACGGCGCTTACGAAGACTTGTCAAGGGCATGGGCCCTGGTCATCAACGAG
GCTGGCAAGAGAGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACGAGACGCTGTCACGACACAACGAGCAG
TCGGGAGGACGGCTGGGGCTGGCCATGTCGGCCATGGGCAGCAACGTCGGCTGGATGGCCTCGAACCAGCCGGCG
TTCCCCGTCGAGCAGTCGTCGATTCTCAACCAGCTAATATCCGGAGCTTACGGGTCGGCCGTGCGGGTAGGACCC
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail