Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4032
Gene name
Locationscaffold_315:4383..5439
Strand-
Gene length (bp)1056
Transcript length (bp)900
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08559 Cut8 Cut8, nuclear proteasome tether protein 1.4E-70 36 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9ES90|STS1_METRA Tethering factor for nuclear proteasome STS1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=STS1 PE=3 SV=1 1 299 2.0E-161
sp|C7YRR5|STS1_NECH7 Tethering factor for nuclear proteasome STS1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=STS1 PE=3 SV=1 1 293 1.0E-143
sp|A4QYI9|STS1_MAGO7 Tethering factor for nuclear proteasome STS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=STS1 PE=3 SV=1 1 299 1.0E-132
sp|E3QDN5|STS1_COLGM Tethering factor for nuclear proteasome STS1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=STS1 PE=3 SV=1 1 299 3.0E-131
sp|Q9C224|STS1_NEUCR Tethering factor for nuclear proteasome sts1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sts1 PE=3 SV=1 1 299 2.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9ES90|STS1_METRA Tethering factor for nuclear proteasome STS1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=STS1 PE=3 SV=1 1 299 2.0E-161
sp|C7YRR5|STS1_NECH7 Tethering factor for nuclear proteasome STS1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=STS1 PE=3 SV=1 1 293 1.0E-143
sp|A4QYI9|STS1_MAGO7 Tethering factor for nuclear proteasome STS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=STS1 PE=3 SV=1 1 299 1.0E-132
sp|E3QDN5|STS1_COLGM Tethering factor for nuclear proteasome STS1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=STS1 PE=3 SV=1 1 299 3.0E-131
sp|Q9C224|STS1_NEUCR Tethering factor for nuclear proteasome sts1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sts1 PE=3 SV=1 1 299 2.0E-120
sp|D1ZMW1|STS1_SORMK Tethering factor for nuclear proteasome STS1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=STS1 PE=3 SV=1 1 299 1.0E-118
sp|B2B7W0|STS1_PODAN Tethering factor for nuclear proteasome STS1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=STS1 PE=3 SV=1 26 299 9.0E-108
sp|A7EZ71|STS1_SCLS1 Tethering factor for nuclear proteasome sts1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sts1 PE=3 SV=1 1 299 3.0E-105
sp|C6H861|STS1_AJECH Tethering factor for nuclear proteasome STS1 OS=Ajellomyces capsulatus (strain H143) GN=STS1 PE=3 SV=1 1 299 5.0E-91
sp|C0NIT8|STS1_AJECG Tethering factor for nuclear proteasome STS1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=STS1 PE=3 SV=1 1 299 5.0E-91
sp|C5JJ91|STS1_AJEDS Tethering factor for nuclear proteasome STS1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=STS1 PE=3 SV=1 1 299 2.0E-89
sp|C5GE44|STS1_AJEDR Tethering factor for nuclear proteasome STS1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=STS1 PE=3 SV=1 1 299 2.0E-89
sp|A6R7I3|STS1_AJECN Tethering factor for nuclear proteasome STS1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=STS1 PE=3 SV=1 1 299 2.0E-89
sp|B6Q1K5|STS1_TALMQ Tethering factor for nuclear proteasome sts1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sts1 PE=3 SV=1 1 299 6.0E-87
sp|B8LTU5|STS1_TALSN Tethering factor for nuclear proteasome sts1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sts1 PE=3 SV=1 1 299 8.0E-87
sp|A1CH27|STS1_ASPCL Tethering factor for nuclear proteasome sts1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sts1 PE=3 SV=1 1 299 7.0E-86
sp|E9D0S5|STS1_COCPS Tethering factor for nuclear proteasome STS1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=STS1 PE=3 SV=1 1 299 1.0E-85
sp|C5P8M7|STS1_COCP7 Tethering factor for nuclear proteasome STS1 OS=Coccidioides posadasii (strain C735) GN=STS1 PE=3 SV=1 1 299 1.0E-85
sp|B6HUK8|STS1_PENRW Tethering factor for nuclear proteasome sts1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sts1 PE=3 SV=1 1 299 3.0E-84
sp|E5R332|STS1_ARTGP Tethering factor for nuclear proteasome STS1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=STS1 PE=3 SV=1 1 299 2.0E-83
sp|C0SIQ6|STS1_PARBP Tethering factor for nuclear proteasome STS1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=STS1 PE=3 SV=1 1 299 2.0E-83
sp|C1GLQ3|STS1_PARBD Tethering factor for nuclear proteasome STS1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=STS1 PE=3 SV=1 1 299 2.0E-83
sp|Q2UGF7|STS1_ASPOR Tethering factor for nuclear proteasome sts1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sts1 PE=3 SV=1 1 299 2.0E-83
sp|B8N9X2|STS1_ASPFN Tethering factor for nuclear proteasome sts1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sts1 PE=3 SV=1 1 299 2.0E-83
sp|C1HAE1|STS1_PARBA Tethering factor for nuclear proteasome STS1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=STS1 PE=3 SV=1 1 299 3.0E-82
sp|Q0USL4|STS1_PHANO Tethering factor for nuclear proteasome STS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=STS1 PE=3 SV=1 18 299 6.0E-82
sp|Q5B4W9|STS1_EMENI Tethering factor for nuclear proteasome sts1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sts1 PE=3 SV=1 1 299 4.0E-81
sp|A1CXR0|STS1_NEOFI Tethering factor for nuclear proteasome sts1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sts1 PE=3 SV=1 1 299 6.0E-81
sp|E3RPB1|STS1_PYRTT Tethering factor for nuclear proteasome sts1 OS=Pyrenophora teres f. teres (strain 0-1) GN=sts1 PE=3 SV=1 1 299 8.0E-81
sp|B0Y5Q9|STS1_ASPFC Tethering factor for nuclear proteasome sts1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sts1 PE=3 SV=1 1 299 9.0E-81
sp|B2W0D9|STS1_PYRTR Tethering factor for nuclear proteasome sts1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sts1 PE=3 SV=1 1 299 1.0E-80
sp|Q4WNW3|STS1_ASPFU Tethering factor for nuclear proteasome sts1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sts1 PE=3 SV=1 1 299 1.0E-79
sp|Q0CLE0|STS1_ASPTN Tethering factor for nuclear proteasome sts1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sts1 PE=3 SV=1 1 299 2.0E-78
sp|C5FF22|STS1_ARTOC Tethering factor for nuclear proteasome STS1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=STS1 PE=3 SV=1 1 227 3.0E-50
sp|Q6CH63|STS1_YARLI Tethering factor for nuclear proteasome STS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STS1 PE=3 SV=1 66 257 1.0E-35
sp|C4YCB9|STS1_CLAL4 Tethering factor for nuclear proteasome STS1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=STS1 PE=3 SV=1 66 261 1.0E-33
sp|Q6BWL0|STS1_DEBHA Tethering factor for nuclear proteasome STS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STS1 PE=3 SV=2 20 230 5.0E-29
sp|B9W900|STS1_CANDC Tethering factor for nuclear proteasome STS1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=STS1 PE=3 SV=1 33 233 1.0E-27
sp|C4YD57|STS1_CANAW Tethering factor for nuclear proteasome STS1 OS=Candida albicans (strain WO-1) GN=STS1 PE=3 SV=1 33 233 9.0E-27
sp|Q5APB6|STS1_CANAL Tethering factor for nuclear proteasome STS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=STS1 PE=3 SV=1 33 233 9.0E-27
sp|C5MBD4|STS1_CANTT Tethering factor for nuclear proteasome STS1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=STS1 PE=3 SV=1 22 228 7.0E-26
sp|A5DEJ2|STS1_PICGU Tethering factor for nuclear proteasome STS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=STS1 PE=3 SV=2 24 294 1.0E-25
sp|A5DSS9|STS1_LODEL Tethering factor for nuclear proteasome STS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=STS1 PE=3 SV=1 65 250 2.0E-23
sp|C5DHJ9|STS1_LACTC Tethering factor for nuclear proteasome STS1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=STS1 PE=3 SV=1 26 260 6.0E-23
sp|P38937|CUT8_SCHPO Tethering factor for nuclear proteasome cut8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut8 PE=1 SV=1 36 260 1.0E-22
sp|Q6FKQ4|STS1_CANGA Tethering factor for nuclear proteasome STS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STS1 PE=3 SV=1 75 262 2.0E-18
sp|C4R591|STS1_PICPG Tethering factor for nuclear proteasome STS1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=STS1 PE=3 SV=1 37 221 1.0E-16
sp|E7RAM2|STS1_OGAPD Tethering factor for nuclear proteasome STS1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=STS1 PE=3 SV=2 36 205 5.0E-16
sp|P38637|STS1_YEAST Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STS1 PE=1 SV=1 75 253 5.0E-15
sp|C8ZAR0|STS1_YEAS8 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=STS1 PE=3 SV=1 75 253 5.0E-15
sp|B3LTJ8|STS1_YEAS1 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=STS1 PE=3 SV=1 75 253 5.0E-15
sp|E7QG80|STS1_YEASZ Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=STS1 PE=3 SV=1 75 253 6.0E-15
sp|E7LVV3|STS1_YEASV Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=STS1 PE=3 SV=1 75 253 6.0E-15
sp|E7KDX7|STS1_YEASA Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain AWRI796) GN=STS1 PE=3 SV=1 75 253 6.0E-15
sp|C7GJG1|STS1_YEAS2 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain JAY291) GN=STS1 PE=3 SV=1 75 253 7.0E-15
sp|E7KPZ3|STS1_YEASL Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=STS1 PE=3 SV=1 75 253 8.0E-15
sp|A6ZVT0|STS1_YEAS7 Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=STS1 PE=3 SV=1 75 253 2.0E-14
sp|Q6CQN1|STS1_KLULA Tethering factor for nuclear proteasome STS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STS1 PE=3 SV=1 35 279 6.0E-13
sp|Q74ZG4|STS1_ASHGO Tethering factor for nuclear proteasome STS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STS1 PE=3 SV=2 62 257 2.0E-12
sp|C5DWK1|STS1_ZYGRC Tethering factor for nuclear proteasome STS1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=STS1 PE=3 SV=1 31 262 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system Yes
GO:0031144 proteasome localization Yes
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No
GO:0030163 protein catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0051179 localization No
GO:0019941 modification-dependent protein catabolic process No
GO:0009056 catabolic process No
GO:0006508 proteolysis No
GO:0044238 primary metabolic process No
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0031503 protein-containing complex localization No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0019538 protein metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0010498 proteasomal protein catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4032
MNVLLSPQPPVFPHQRENYRLSPQRSVSPLHGMAPRKRKADADGDETMSPLSSPAAAARPLARPAKRSRINETFG
RSLTPHRLLETLDAGQLRVVLERICEQHPQIGQEVIAGAPRPSVSCALDVLQGYHDKLKTAFPYGQSSPDYTYHR
IKEPMVALTEALSDFTLQFLPPTESQPTRSLRYLDGATKLVHQLPDWDSQAYRHHKDGAYEDLSRAWALVINEAG
KRGGGINLHSGGWDETLSRHNEQSGGRLGLAMSAMGSNVGWMASNQPAFPVEQSSILNQLISGAYGSAVRVGPW
Coding >Ophio5|4032
ATGAACGTGTTGCTTTCGCCGCAGCCGCCTGTCTTTCCTCATCAACGCGAAAATTACCGCCTTTCGCCTCAACGA
TCAGTATCTCCACTGCACGGCATGGCACCGCGAAAACGGAAAGCAGACGCCGATGGCGACGAGACCATGTCACCT
TTGAGCTCCCCCGCTGCTGCCGCGAGGCCACTCGCCCGACCGGCCAAAAGATCGAGAATTAATGAGACCTTTGGC
CGGTCGCTGACTCCCCATCGATTGCTCGAGACTCTCGATGCCGGCCAATTGCGCGTCGTCCTGGAACGCATCTGC
GAACAACATCCACAGATCGGCCAGGAAGTCATCGCCGGCGCCCCGCGTCCTTCCGTTTCATGCGCCCTCGACGTC
TTGCAAGGCTACCACGACAAGCTCAAGACGGCTTTTCCTTACGGCCAGTCGAGCCCTGACTACACCTACCACCGC
ATTAAGGAGCCCATGGTCGCCCTCACCGAAGCCCTTTCCGACTTTACGCTCCAATTTCTCCCGCCCACCGAAAGC
CAGCCCACCAGGTCGCTGCGGTACCTCGATGGTGCCACCAAGCTCGTCCATCAGCTGCCAGACTGGGACTCGCAA
GCATATCGCCACCACAAAGACGGCGCTTACGAAGACTTGTCAAGGGCATGGGCCCTGGTCATCAACGAGGCTGGC
AAGAGAGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACGAGACGCTGTCACGACACAACGAGCAGTCGGGA
GGACGGCTGGGGCTGGCCATGTCGGCCATGGGCAGCAACGTCGGCTGGATGGCCTCGAACCAGCCGGCGTTCCCC
GTCGAGCAGTCGTCGATTCTCAACCAGCTAATATCCGGAGCTTACGGGTCGGCCGTGCGGGTAGGACCCTGG
Transcript >Ophio5|4032
ATGAACGTGTTGCTTTCGCCGCAGCCGCCTGTCTTTCCTCATCAACGCGAAAATTACCGCCTTTCGCCTCAACGA
TCAGTATCTCCACTGCACGGCATGGCACCGCGAAAACGGAAAGCAGACGCCGATGGCGACGAGACCATGTCACCT
TTGAGCTCCCCCGCTGCTGCCGCGAGGCCACTCGCCCGACCGGCCAAAAGATCGAGAATTAATGAGACCTTTGGC
CGGTCGCTGACTCCCCATCGATTGCTCGAGACTCTCGATGCCGGCCAATTGCGCGTCGTCCTGGAACGCATCTGC
GAACAACATCCACAGATCGGCCAGGAAGTCATCGCCGGCGCCCCGCGTCCTTCCGTTTCATGCGCCCTCGACGTC
TTGCAAGGCTACCACGACAAGCTCAAGACGGCTTTTCCTTACGGCCAGTCGAGCCCTGACTACACCTACCACCGC
ATTAAGGAGCCCATGGTCGCCCTCACCGAAGCCCTTTCCGACTTTACGCTCCAATTTCTCCCGCCCACCGAAAGC
CAGCCCACCAGGTCGCTGCGGTACCTCGATGGTGCCACCAAGCTCGTCCATCAGCTGCCAGACTGGGACTCGCAA
GCATATCGCCACCACAAAGACGGCGCTTACGAAGACTTGTCAAGGGCATGGGCCCTGGTCATCAACGAGGCTGGC
AAGAGAGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACGAGACGCTGTCACGACACAACGAGCAGTCGGGA
GGACGGCTGGGGCTGGCCATGTCGGCCATGGGCAGCAACGTCGGCTGGATGGCCTCGAACCAGCCGGCGTTCCCC
GTCGAGCAGTCGTCGATTCTCAACCAGCTAATATCCGGAGCTTACGGGTCGGCCGTGCGGGTAGGACCCTGGTAG
Gene >Ophio5|4032
ATGAACGTGTTGCTTTCGCCGCAGCCGCCTGTCTTTCCTCATCAACGCGAAAATTACCGCCTTTCGCCTCAACGA
TCAGGTACCTTGTCCCCCTCCCTGCCAGGCTTCCTGCATGCGTAATTGGCCGGGTCCACCGCCTCAACATGTCCA
AAACAAAGGCCGCGCATGCCACACCACCACTTTCTTCGTCTCGTCTCCTTTTCTCATGACGCTAATTGCACAAAC
ATAACTTCAGTATCTCCACTGCACGGCATGGCACCGCGAAAACGGAAAGCAGACGCCGATGGCGACGAGACCATG
TCACCTTTGAGCTCCCCCGCTGCTGCCGCGAGGCCACTCGCCCGACCGGCCAAAAGATCGAGAATTAATGAGACC
TTTGGCCGGTCGCTGACTCCCCATCGATTGCTCGAGACTCTCGATGCCGGCCAATTGCGCGTCGTCCTGGAACGC
ATCTGCGAACAACATCCACAGATCGGCCAGGAAGTCATCGCCGGCGCCCCGCGTCCTTCCGTTTCATGCGCCCTC
GACGTCTTGCAAGGCTACCACGACAAGCTCAAGACGGCTTTTCCTTACGGCCAGTCGAGCCCTGACTACACCTAC
CACCGCATTAAGGAGCCCATGGTCGCCCTCACCGAAGCCCTTTCCGACTTTACGCTCCAATTTCTCCCGCCCACC
GAAAGCCAGCCCACCAGGTCGCTGCGGTACCTCGATGGTGCCACCAAGCTCGTCCATCAGCTGCCAGACTGGGAC
TCGCAAGCATATCGCCACCACAAAGACGGCGCTTACGAAGACTTGTCAAGGGCATGGGCCCTGGTCATCAACGAG
GCTGGCAAGAGAGGCGGCGGCATCAACCTGCACTCGGGCGGCTGGGACGAGACGCTGTCACGACACAACGAGCAG
TCGGGAGGACGGCTGGGGCTGGCCATGTCGGCCATGGGCAGCAACGTCGGCTGGATGGCCTCGAACCAGCCGGCG
TTCCCCGTCGAGCAGTCGTCGATTCTCAACCAGCTAATATCCGGAGCTTACGGGTCGGCCGTGCGGGTAGGACCC
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail