Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|403
Gene name
Locationscaffold_11:5506..6582
Strand+
Gene length (bp)1076
Transcript length (bp)966
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1628 0.1694 0.1436 0.5237 0.1571 0.0278 0.6448 0.6386 0.328 0.0055

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 110 129 19
4 166 188 22
5 223 245 22
6 260 279 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 14.45 5.29 23.60
CcL In ants, during behavior modification 81.30 43.57 119.03
CcD In ants, recently dead 113.66 60.17 167.14

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.155946 no

Orthologs

Orthofinder run ID4
Orthogroup3632
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|413
Ophiocordyceps australis map64 (Brazil) OphauB2|1829
Ophiocordyceps camponoti-floridani Ophcf2|03196
Ophiocordyceps camponoti-rufipedis Ophun1|6228
Ophiocordyceps kimflemingae Ophio5|403 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7014

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|403
MPACPVQGNADLYGLGIRIGLYIQMITVQLSGILSASFSVDDHIGQGTIVFVLSTVIILVRLINASIGNETSTGG
DDDPALEAVEIFPVLTLLLVQTGVCRVTSRNRLTMLVWVAELVGLAALYNYFWWRGMDLLPRSCQDDKAFFFARV
SIWGWYRSLNKAFGVLAAIGVALTLVTYCGSVIYEVVFCVVRFVLRRTNDGSSSSSSSSGTNSNTAGVKEKPGLT
LGSVDLLANVGAIVYVEVSLRWNSITGVHSLDSPGQFMPLVIALGQFLSVFYSAAKEMLRRRANDDFSGDEDEAA
AECHHHDQKTLPLAQAHTATT
Coding >Ophio5|403
ATGCCCGCCTGCCCTGTCCAAGGTAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGCCTCTATATCCAAATG
ATCACCGTTCAGCTCTCCGGAATCCTCAGTGCTAGCTTCAGCGTCGACGACCACATCGGCCAAGGCACCATCGTC
TTTGTCCTCTCCACCGTCATCATCCTCGTCCGCCTCATCAATGCCAGCATCGGCAACGAGACCAGCACCGGCGGC
GACGACGATCCCGCCCTCGAGGCCGTCGAGATCTTTCCCGTCTTAACCCTTCTTCTGGTACAGACCGGCGTGTGT
CGCGTCACGTCCAGGAATCGTCTCACCATGCTCGTCTGGGTCGCCGAGCTCGTCGGACTGGCCGCCTTGTACAAC
TATTTCTGGTGGCGCGGCATGGACTTGCTGCCGCGGTCGTGCCAGGACGACAAGGCTTTTTTCTTCGCGCGTGTT
AGTATCTGGGGCTGGTATCGTAGCCTGAACAAGGCGTTTGGAGTACTTGCTGCCATCGGCGTTGCCTTGACGCTA
GTCACCTACTGCGGATCCGTCATATACGAGGTCGTCTTCTGCGTCGTCCGCTTCGTGCTGAGACGCACCAACGAC
GGCAGCAGCAGCAGCAGCAGCAGCAGCGGGACCAACAGCAACACCGCCGGGGTCAAGGAAAAGCCCGGCCTGACC
CTCGGCTCCGTCGACCTGCTGGCCAACGTCGGCGCCATCGTCTACGTCGAAGTCTCGCTGCGTTGGAACAGCATC
ACGGGTGTGCACTCGCTCGACAGCCCGGGCCAATTCATGCCCCTGGTCATCGCCCTGGGCCAGTTCCTGTCCGTC
TTCTACTCCGCCGCCAAGGAGATGCTCCGGCGACGCGCCAACGACGACTTCTCGGGAGACGAAGACGAGGCTGCG
GCCGAGTGTCACCACCACGATCAAAAGACGCTGCCTCTCGCCCAAGCACATACTGCCACGACA
Transcript >Ophio5|403
ATGCCCGCCTGCCCTGTCCAAGGTAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGCCTCTATATCCAAATG
ATCACCGTTCAGCTCTCCGGAATCCTCAGTGCTAGCTTCAGCGTCGACGACCACATCGGCCAAGGCACCATCGTC
TTTGTCCTCTCCACCGTCATCATCCTCGTCCGCCTCATCAATGCCAGCATCGGCAACGAGACCAGCACCGGCGGC
GACGACGATCCCGCCCTCGAGGCCGTCGAGATCTTTCCCGTCTTAACCCTTCTTCTGGTACAGACCGGCGTGTGT
CGCGTCACGTCCAGGAATCGTCTCACCATGCTCGTCTGGGTCGCCGAGCTCGTCGGACTGGCCGCCTTGTACAAC
TATTTCTGGTGGCGCGGCATGGACTTGCTGCCGCGGTCGTGCCAGGACGACAAGGCTTTTTTCTTCGCGCGTGTT
AGTATCTGGGGCTGGTATCGTAGCCTGAACAAGGCGTTTGGAGTACTTGCTGCCATCGGCGTTGCCTTGACGCTA
GTCACCTACTGCGGATCCGTCATATACGAGGTCGTCTTCTGCGTCGTCCGCTTCGTGCTGAGACGCACCAACGAC
GGCAGCAGCAGCAGCAGCAGCAGCAGCGGGACCAACAGCAACACCGCCGGGGTCAAGGAAAAGCCCGGCCTGACC
CTCGGCTCCGTCGACCTGCTGGCCAACGTCGGCGCCATCGTCTACGTCGAAGTCTCGCTGCGTTGGAACAGCATC
ACGGGTGTGCACTCGCTCGACAGCCCGGGCCAATTCATGCCCCTGGTCATCGCCCTGGGCCAGTTCCTGTCCGTC
TTCTACTCCGCCGCCAAGGAGATGCTCCGGCGACGCGCCAACGACGACTTCTCGGGAGACGAAGACGAGGCTGCG
GCCGAGTGTCACCACCACGATCAAAAGACGCTGCCTCTCGCCCAAGCACATACTGCCACGACATGA
Gene >Ophio5|403
ATGCCCGCCTGCCCTGTCCAAGGTAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGCCTCTATATCCAAATG
ATCACCGTTCAGCTCTCCGGAATCCTCAGTGCTAGCTTCAGCGTCGACGACCACATCGGCCAAGGCACCATCGTC
TTTGTCCTCTCCACCGTCATCATCCTCGTCCGCCTCATCAATGCCAGCATCGGCAACGAGACCAGCACCGGCGGC
GACGACGATCCCGCCCTCGAGGCCGTCGAGATCTTTCCCGTCTTAACCCTTCTTCTGGTACAGACCGGCGTGTGT
CGCGTCACGTCCAGGAATCGTCTCACCATGCTCGTCTGGGTCGCCGAGCTCGTCGGACTGGCCGCCTTGTACAAC
TATTTCTGGTGGCGCGGCATGGACTTGCTGCCGCGGTCGTGCCAGGACGACAAGGCTTTTTTCTTCGCGCGTGTT
AGTATCTGGGGCTGGTATCGTAGCCTGAACAAGGCGTTTGGAGTACTTGCTGCCATCGGCGTTGCCTTGACGCTA
GTCACCTACTGCGGATGTGAGTTGTTGGTCAGAAAAGGGGGGCGGAATCCGTCTGACCAAACCGTCTAGCCGTCA
TATACGAGGTCGTCTTCTGCGTCGTCCGCTTCGTGCTGAGACGCACCAACGACGGCAGCAGCAGCAGCAGCAGCA
GCAGCGGGACCAACAGCAACACCGCCGGGGTCAAGGAAAAGCCCGGCCTGACCCTCGGCTCCGTCGACCTGCTGG
CCAACGTCGGCGCCATCGTCTACGTCGAAGTCTCGCTGCGTTGGAACAGCATCACGGGTGTGCACTCGCTCGACA
GCCCGGGCCAATTCATGCCCCTGGTCATCGCCCTGGGCCAGTTCCTGTCCGTCTTCTACTCCGCCGCCAAGGAGA
TGCTCCGGCGACGCGCCAACGACGACTTCTCGGGAGACGAAGACGGTGAGGATGCCGGAACTGTATCCCGTCTCC
TTGTCGCCTTTGCTGACGATGATATAGAGGCTGCGGCCGAGTGTCACCACCACGATCAAAAGACGCTGCCTCTCG
CCCAAGCACATACTGCCACGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail