Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4027
Gene name
Locationscaffold_314:11092..12836
Strand-
Gene length (bp)1744
Transcript length (bp)1629
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 2.8E-44 45 368
PF11954 DUF3471 Domain of unknown function (DUF3471) 1.0E-08 420 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 48 365 2.0E-13
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 48 365 3.0E-13
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 48 365 5.0E-13
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 48 365 2.0E-12
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 48 365 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 48 365 2.0E-13
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 48 365 3.0E-13
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 48 365 5.0E-13
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 48 365 2.0E-12
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 48 365 2.0E-12
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 48 365 2.0E-12
sp|Q9KJ74|FLP_STAAU Protein flp OS=Staphylococcus aureus GN=flp PE=4 SV=1 48 365 2.0E-11
sp|Q2FVH6|FLP_STAA8 Protein flp OS=Staphylococcus aureus (strain NCTC 8325) GN=flp PE=4 SV=1 48 365 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4027
MRSKSSVSTVACLVLRLMTATSAHAAEQRASKLSPFTDEFGLFARDALHEYHTAGLSIAVIDGGQIFAEGYGNAT
LPDKPARPDTLWYVGSTTKALVAAVLGQLIDSKAYPALARGWRTPISSLIRDDFVLQDDWATDHVTLEDAASHQS
GLTAHDESVRYSANNSKHIVRDTVRNLRNLPMHLEPHLEFHYNNQMYTALQLVIETLTGKWLGHLLKDMLWRPLG
MHSSYFDLKEALAGPEHLSTGYYWDARESKLRPMPLMPTDPMNASGAVISTVVDFAAWIRCLLRRTEPLSETVHR
ELTKPRLVQSPEPGLGTDVTLYSLGWFRTTLYGQVAYWHSGSVDTHGALIYWFPDLDYGVVLFANYPGIVRYVLM
WRLIEDKLRVPKNKRFNIGERMRRDEESEKRTIANATNVLYPDRPKSPLPPSLKPSAFAGRYHNAGYGTIDLEVK
PHPSKPDETILVADRKDFEVRYQLKLHHVSGDFWVAYIESPDRAPGPTLFYRAQFALGSDGKAASLAITLYNREE
MVLEGVAVYDRVEDVDI
Coding >Ophio5|4027
ATGAGGAGCAAGTCCTCCGTGTCGACAGTGGCCTGTTTGGTCCTTCGCCTCATGACCGCTACCAGCGCCCACGCA
GCGGAGCAGAGAGCCAGCAAGCTGAGCCCCTTCACCGACGAGTTCGGCCTATTCGCCAGAGATGCTCTGCATGAG
TATCACACAGCTGGACTGTCCATTGCCGTCATCGACGGGGGCCAAATCTTCGCCGAGGGCTATGGCAACGCGACG
CTGCCCGACAAGCCAGCCAGGCCCGACACGCTTTGGTATGTCGGTTCGACGACAAAGGCCCTCGTAGCCGCTGTC
CTCGGCCAGCTCATCGACTCCAAGGCGTATCCGGCCCTGGCGCGAGGTTGGAGGACGCCGATATCGTCGCTGATT
CGGGATGATTTCGTGCTGCAGGACGACTGGGCTACGGACCATGTTACGCTCGAGGACGCGGCTAGCCATCAGTCG
GGTCTCACGGCCCATGATGAGAGTGTGCGATACTCGGCCAACAACTCCAAGCACATTGTCCGCGATACGGTCCGG
AACCTGCGCAACCTGCCGATGCATCTTGAGCCTCACCTCGAGTTTCACTATAATAATCAGATGTACACGGCCCTG
CAGCTCGTCATCGAGACGCTGACGGGCAAGTGGCTCGGACATTTGCTCAAGGACATGCTTTGGCGTCCGCTAGGC
ATGCACTCGTCCTACTTTGACCTGAAGGAGGCCCTCGCCGGCCCGGAGCACCTCTCGACGGGATACTACTGGGAC
GCGCGCGAATCCAAGCTCAGGCCCATGCCCCTGATGCCGACGGACCCGATGAACGCCTCGGGAGCCGTCATCTCG
ACCGTCGTCGACTTTGCCGCCTGGATCCGCTGTCTGCTGCGACGGACCGAGCCCCTCTCCGAGACGGTCCATAGG
GAACTGACGAAGCCGCGGCTGGTGCAGAGCCCGGAGCCCGGTTTGGGCACCGACGTCACCCTGTACTCGCTGGGT
TGGTTCCGAACGACGCTGTACGGCCAGGTGGCCTACTGGCATTCGGGTTCCGTCGACACGCACGGCGCTCTAATA
TACTGGTTCCCGGACCTCGACTACGGCGTCGTTTTGTTCGCCAACTATCCGGGTATTGTGCGCTACGTCCTGATG
TGGCGGCTGATCGAGGATAAGCTTCGTGTGCCCAAGAACAAGCGGTTCAACATTGGGGAAAGGATGAGACGGGAT
GAGGAGTCGGAAAAGCGCACCATTGCCAACGCGACCAACGTCCTCTACCCTGATCGACCCAAATCTCCGTTGCCA
CCGTCGCTGAAGCCGTCAGCTTTTGCCGGTCGCTATCACAACGCGGGCTACGGCACCATAGACCTTGAAGTGAAG
CCGCATCCGTCCAAGCCCGACGAGACGATTCTGGTGGCGGACCGCAAAGACTTTGAGGTTAGATACCAGCTAAAG
CTTCATCACGTCTCGGGCGACTTCTGGGTTGCCTACATCGAGTCGCCTGACCGGGCGCCCGGCCCGACTTTGTTC
TACCGGGCGCAGTTTGCGCTGGGCAGTGACGGCAAGGCGGCGAGTCTGGCCATTACTCTGTATAATCGGGAGGAG
ATGGTGCTCGAGGGAGTCGCCGTTTACGACCGGGTTGAAGACGTGGACATT
Transcript >Ophio5|4027
ATGAGGAGCAAGTCCTCCGTGTCGACAGTGGCCTGTTTGGTCCTTCGCCTCATGACCGCTACCAGCGCCCACGCA
GCGGAGCAGAGAGCCAGCAAGCTGAGCCCCTTCACCGACGAGTTCGGCCTATTCGCCAGAGATGCTCTGCATGAG
TATCACACAGCTGGACTGTCCATTGCCGTCATCGACGGGGGCCAAATCTTCGCCGAGGGCTATGGCAACGCGACG
CTGCCCGACAAGCCAGCCAGGCCCGACACGCTTTGGTATGTCGGTTCGACGACAAAGGCCCTCGTAGCCGCTGTC
CTCGGCCAGCTCATCGACTCCAAGGCGTATCCGGCCCTGGCGCGAGGTTGGAGGACGCCGATATCGTCGCTGATT
CGGGATGATTTCGTGCTGCAGGACGACTGGGCTACGGACCATGTTACGCTCGAGGACGCGGCTAGCCATCAGTCG
GGTCTCACGGCCCATGATGAGAGTGTGCGATACTCGGCCAACAACTCCAAGCACATTGTCCGCGATACGGTCCGG
AACCTGCGCAACCTGCCGATGCATCTTGAGCCTCACCTCGAGTTTCACTATAATAATCAGATGTACACGGCCCTG
CAGCTCGTCATCGAGACGCTGACGGGCAAGTGGCTCGGACATTTGCTCAAGGACATGCTTTGGCGTCCGCTAGGC
ATGCACTCGTCCTACTTTGACCTGAAGGAGGCCCTCGCCGGCCCGGAGCACCTCTCGACGGGATACTACTGGGAC
GCGCGCGAATCCAAGCTCAGGCCCATGCCCCTGATGCCGACGGACCCGATGAACGCCTCGGGAGCCGTCATCTCG
ACCGTCGTCGACTTTGCCGCCTGGATCCGCTGTCTGCTGCGACGGACCGAGCCCCTCTCCGAGACGGTCCATAGG
GAACTGACGAAGCCGCGGCTGGTGCAGAGCCCGGAGCCCGGTTTGGGCACCGACGTCACCCTGTACTCGCTGGGT
TGGTTCCGAACGACGCTGTACGGCCAGGTGGCCTACTGGCATTCGGGTTCCGTCGACACGCACGGCGCTCTAATA
TACTGGTTCCCGGACCTCGACTACGGCGTCGTTTTGTTCGCCAACTATCCGGGTATTGTGCGCTACGTCCTGATG
TGGCGGCTGATCGAGGATAAGCTTCGTGTGCCCAAGAACAAGCGGTTCAACATTGGGGAAAGGATGAGACGGGAT
GAGGAGTCGGAAAAGCGCACCATTGCCAACGCGACCAACGTCCTCTACCCTGATCGACCCAAATCTCCGTTGCCA
CCGTCGCTGAAGCCGTCAGCTTTTGCCGGTCGCTATCACAACGCGGGCTACGGCACCATAGACCTTGAAGTGAAG
CCGCATCCGTCCAAGCCCGACGAGACGATTCTGGTGGCGGACCGCAAAGACTTTGAGGTTAGATACCAGCTAAAG
CTTCATCACGTCTCGGGCGACTTCTGGGTTGCCTACATCGAGTCGCCTGACCGGGCGCCCGGCCCGACTTTGTTC
TACCGGGCGCAGTTTGCGCTGGGCAGTGACGGCAAGGCGGCGAGTCTGGCCATTACTCTGTATAATCGGGAGGAG
ATGGTGCTCGAGGGAGTCGCCGTTTACGACCGGGTTGAAGACGTGGACATTTGA
Gene >Ophio5|4027
ATGAGGAGCAAGTCCTCCGTGTCGACAGTGGCCTGTTTGGTCCTTCGCCTCATGACCGCTACCAGCGCCCACGCA
GCGGAGCAGAGAGCCAGCAAGCTGAGCCCCTTCACCGACGAGTTCGGCCTATTCGCCAGAGATGCTCTGCATGAG
TATCACACAGCTGGACTGTCCATTGCCGTCATCGACGGGGGCCAAATCTTCGCCGAGGTCTCGCGTCTCGCCACC
GCTTCTCGGCCAACTGCTGACCGAGTTCTTGCTCATAGGGCTATGGCAACGCGACGCTGCCCGACAAGCCAGCCA
GGCCCGACACGCTTTGGTATGTCGGTTCGACGACAAAGGCCCTCGTAGCCGCTGTCCTCGGCCAGCTCATCGACT
CCAAGGCGTATCCGGCCCTGGCGCGAGGTTGGAGGACGCCGATATCGTCGCTGATTCGGGATGATTTCGTGCTGC
AGGACGACTGGGCTACGGACCATGTTACGCTCGAGGACGCGGCTAGCCATCAGTCGGGTCTCACGGCCCATGATG
AGAGTGTGCGATACTCGGCCAACAACTCCAAGCACATTGTCCGCGATACGGTCCGGAACCTGCGCAACCTGCCGA
TGCATCTTGAGCCTCACCTCGAGTTTCACTATAATAATCAGATGTACACGGCCCTGCAGCTCGTCATCGAGACGC
TGACGGGCAAGTGGCTCGGACATTTGCTCAAGGACATGCTTTGGCGTCCGCTAGGCATGCACTCGTCCTACTTTG
ACCTGAAGGAGGCCCTCGCCGGCCCGGAGCACCTCTCGACGGGATACTACTGGGACGCGCGCGAATCCAAGCTCA
GGCCCATGCCCCTGATGCCGACGGACCCGATGAACGCCTCGGGAGCCGTCATCTCGACCGTCGTCGACTTTGCCG
CCTGGATCCGCTGTCTGCTGCGACGGACCGAGCCCCTCTCCGAGACGGTCCATAGGGAACTGACGAAGCCGCGGC
TGGTGCAGAGCCCGGAGCCCGGTTTGGGCACCGACGTCACCCTGTACTCGCTGGGTTGGTTCCGAACGACGCTGT
ACGGCCAGGTGGCCTACTGGCATTCGGGTTCCGTCGACACGCACGGCGCTCTAATATACTGGTTCCCGGACCTCG
ACTACGGCGTCGTTTTGTTCGCCAACTATCCGGGTATTGTGCGCTACGTCCTGATGTGGCGGCTGATCGAGGATA
AGCTTCGTGTGCCCAAGAACAAGCGGTTCAACATTGGGGAAAGGTCGGTGCAGTCTTCTTGTCCTGTTACGTTTA
GCTGACACAACCTTTCGAGTCGTATAGGATGAGACGGGATGAGGAGTCGGAAAAGCGCACCATTGCCAACGCGAC
CAACGTCCTCTACCCTGATCGACCCAAATCTCCGTTGCCACCGTCGCTGAAGCCGTCAGCTTTTGCCGGTCGCTA
TCACAACGCGGGCTACGGCACCATAGACCTTGAAGTGAAGCCGCATCCGTCCAAGCCCGACGAGACGATTCTGGT
GGCGGACCGCAAAGACTTTGAGGTTAGATACCAGCTAAAGCTTCATCACGTCTCGGGCGACTTCTGGGTTGCCTA
CATCGAGTCGCCTGACCGGGCGCCCGGCCCGACTTTGTTCTACCGGGCGCAGTTTGCGCTGGGCAGTGACGGCAA
GGCGGCGAGTCTGGCCATTACTCTGTATAATCGGGAGGAGATGGTGCTCGAGGGAGTCGCCGTTTACGACCGGGT
TGAAGACGTGGACATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail