Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4005
Gene name
Locationscaffold_311:11218..13051
Strand+
Gene length (bp)1833
Transcript length (bp)1755
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 7.2E-234 13 573

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38875|GPI16_YEAST GPI transamidase component GPI16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI16 PE=1 SV=2 26 567 5.0E-120
sp|O94380|GPI16_SCHPO GPI transamidase component PIG-T homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi16 PE=3 SV=1 6 580 4.0E-99
sp|Q969N2|PIGT_HUMAN GPI transamidase component PIG-T OS=Homo sapiens GN=PIGT PE=1 SV=1 28 552 4.0E-84
sp|Q8BXQ2|PIGT_MOUSE GPI transamidase component PIG-T OS=Mus musculus GN=Pigt PE=1 SV=2 28 552 6.0E-84

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:1905369 endopeptidase complex No
GO:1902494 catalytic complex No
GO:0043412 macromolecule modification No
GO:0098796 membrane protein complex No
GO:1905368 peptidase complex No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0008303 caspase complex No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 529 551 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4005
MRHQPVLVLANLVASLVTLAAAASDYHEQLTLRPLPLSALLASFNFRSNTSLADFDAHHFRLFPRSLGQILQHSR
TRELHLRFTLGRWDAERWGARPWGGAREGGTGVELWAWLDRDADENWLTLTNALSGLFCASLNFIDSTRTTRPVV
SFQPEGHHSDSALGTTSLLHGVLPHEVVCTENLTPFLKLLPCKGKAGIASLLDGHKLFDASFQSMAIDVRPICDS
SGVCVLQMEQTIDMVLDVERSKRPRDNPIPRPPPSQELLCDMYKPYNGDGSCFPTDHLHGQHWALSEIFGRAMKG
VCPLSDGTPPVCLQVPDSRVVFVSGASGDIKDPSGMSRCYLPEDNGAEFNIELTKPSAVDAAAFKDLVQPETPLL
FAERSFMGHGQEHGGVQAILTNPGDNEVEFVYMESLPWFMRIYLHTLSTRISSSSIATNASSRIIEEIYYRPALD
RTRGTQLELLMRIPPRCTVFLTYDFSKSILRYTEYPPDANRGFDVAAAVITTRAPRAGLNLRTTSLLLYLPTPDF
SMPYNVIIFTSTAIALTFGGLYNILVRRLVGADEAPNTMLKNKVGRLLGLLKARLGGGS
Coding >Ophio5|4005
ATGCGTCACCAACCGGTGCTTGTCCTCGCGAACCTCGTGGCCAGCCTCGTGACCCTCGCCGCGGCCGCATCTGAC
TATCACGAGCAGCTCACCTTGCGGCCGCTTCCACTATCAGCCCTTCTCGCGAGCTTCAACTTTCGGTCCAACACG
TCCCTCGCCGACTTTGATGCCCATCACTTTCGCCTCTTCCCAAGGTCGTTGGGCCAGATTCTGCAGCATTCTCGC
ACGCGCGAGCTGCATCTACGCTTCACCCTCGGCCGCTGGGATGCTGAGCGATGGGGTGCTAGACCTTGGGGAGGT
GCTCGTGAGGGCGGTACAGGTGTCGAGCTTTGGGCTTGGTTGGACAGAGACGCCGACGAGAACTGGCTGACGCTA
ACCAATGCCCTCTCCGGCCTCTTTTGTGCCTCACTCAACTTCATCGACTCGACGCGCACTACCCGCCCTGTCGTG
TCCTTTCAGCCCGAGGGTCATCATTCTGATTCCGCTCTCGGGACGACCAGCCTGCTGCATGGCGTTCTCCCGCAC
GAGGTCGTCTGCACCGAGAACCTGACGCCCTTCCTCAAGTTGCTGCCTTGCAAGGGCAAGGCCGGCATCGCCAGC
CTACTCGATGGACACAAGCTGTTTGACGCTTCGTTTCAGAGCATGGCCATTGACGTGAGGCCCATTTGTGACTCG
TCCGGCGTGTGTGTCCTTCAGATGGAGCAGACCATTGACATGGTACTGGATGTCGAACGCTCCAAGCGACCGAGA
GACAACCCCATCCCAAGACCACCTCCTAGCCAGGAGCTCCTCTGCGACATGTACAAGCCCTACAACGGCGACGGC
TCCTGCTTCCCAACTGACCATCTTCATGGCCAGCACTGGGCGCTGTCTGAGATCTTTGGCCGCGCCATGAAGGGC
GTATGTCCCCTTTCCGACGGCACGCCCCCCGTTTGCCTTCAGGTGCCCGACTCTCGAGTCGTCTTCGTTTCCGGC
GCCTCGGGCGATATCAAGGACCCCAGTGGCATGTCGCGATGCTACTTGCCGGAAGACAACGGCGCTGAATTCAAC
ATCGAGCTCACCAAGCCCAGTGCAGTCGATGCGGCGGCATTCAAAGACTTGGTTCAGCCGGAGACGCCACTCCTC
TTTGCAGAGCGCAGTTTCATGGGCCACGGCCAGGAGCATGGTGGCGTCCAGGCCATCTTGACCAATCCTGGCGAC
AACGAGGTTGAGTTTGTCTACATGGAGTCGCTGCCCTGGTTCATGCGCATCTACCTTCACACTCTCTCGACGCGT
ATCTCATCGTCGTCCATCGCTACCAACGCTTCCTCACGGATCATAGAAGAGATCTATTACCGTCCAGCTCTTGAC
CGCACCCGCGGCACTCAGCTCGAGCTCCTCATGCGCATCCCCCCTCGTTGCACCGTCTTCCTCACCTATGATTTC
TCCAAGTCGATCCTCCGCTATACAGAGTATCCGCCAGACGCCAACCGCGGCTTCGACGTTGCAGCCGCTGTTATT
ACGACTCGCGCCCCCCGAGCCGGCCTGAACCTGCGGACTACCAGCCTGCTGCTCTACCTGCCGACGCCGGACTTT
AGCATGCCGTACAATGTCATCATCTTTACATCGACGGCCATTGCTCTGACGTTTGGCGGTTTGTATAATATCCTT
GTGCGGAGGTTGGTGGGCGCGGATGAGGCGCCAAATACGATGCTCAAGAACAAGGTGGGGAGGCTTTTGGGTCTG
CTGAAGGCTAGGCTGGGAGGGGGGAGT
Transcript >Ophio5|4005
ATGCGTCACCAACCGGTGCTTGTCCTCGCGAACCTCGTGGCCAGCCTCGTGACCCTCGCCGCGGCCGCATCTGAC
TATCACGAGCAGCTCACCTTGCGGCCGCTTCCACTATCAGCCCTTCTCGCGAGCTTCAACTTTCGGTCCAACACG
TCCCTCGCCGACTTTGATGCCCATCACTTTCGCCTCTTCCCAAGGTCGTTGGGCCAGATTCTGCAGCATTCTCGC
ACGCGCGAGCTGCATCTACGCTTCACCCTCGGCCGCTGGGATGCTGAGCGATGGGGTGCTAGACCTTGGGGAGGT
GCTCGTGAGGGCGGTACAGGTGTCGAGCTTTGGGCTTGGTTGGACAGAGACGCCGACGAGAACTGGCTGACGCTA
ACCAATGCCCTCTCCGGCCTCTTTTGTGCCTCACTCAACTTCATCGACTCGACGCGCACTACCCGCCCTGTCGTG
TCCTTTCAGCCCGAGGGTCATCATTCTGATTCCGCTCTCGGGACGACCAGCCTGCTGCATGGCGTTCTCCCGCAC
GAGGTCGTCTGCACCGAGAACCTGACGCCCTTCCTCAAGTTGCTGCCTTGCAAGGGCAAGGCCGGCATCGCCAGC
CTACTCGATGGACACAAGCTGTTTGACGCTTCGTTTCAGAGCATGGCCATTGACGTGAGGCCCATTTGTGACTCG
TCCGGCGTGTGTGTCCTTCAGATGGAGCAGACCATTGACATGGTACTGGATGTCGAACGCTCCAAGCGACCGAGA
GACAACCCCATCCCAAGACCACCTCCTAGCCAGGAGCTCCTCTGCGACATGTACAAGCCCTACAACGGCGACGGC
TCCTGCTTCCCAACTGACCATCTTCATGGCCAGCACTGGGCGCTGTCTGAGATCTTTGGCCGCGCCATGAAGGGC
GTATGTCCCCTTTCCGACGGCACGCCCCCCGTTTGCCTTCAGGTGCCCGACTCTCGAGTCGTCTTCGTTTCCGGC
GCCTCGGGCGATATCAAGGACCCCAGTGGCATGTCGCGATGCTACTTGCCGGAAGACAACGGCGCTGAATTCAAC
ATCGAGCTCACCAAGCCCAGTGCAGTCGATGCGGCGGCATTCAAAGACTTGGTTCAGCCGGAGACGCCACTCCTC
TTTGCAGAGCGCAGTTTCATGGGCCACGGCCAGGAGCATGGTGGCGTCCAGGCCATCTTGACCAATCCTGGCGAC
AACGAGGTTGAGTTTGTCTACATGGAGTCGCTGCCCTGGTTCATGCGCATCTACCTTCACACTCTCTCGACGCGT
ATCTCATCGTCGTCCATCGCTACCAACGCTTCCTCACGGATCATAGAAGAGATCTATTACCGTCCAGCTCTTGAC
CGCACCCGCGGCACTCAGCTCGAGCTCCTCATGCGCATCCCCCCTCGTTGCACCGTCTTCCTCACCTATGATTTC
TCCAAGTCGATCCTCCGCTATACAGAGTATCCGCCAGACGCCAACCGCGGCTTCGACGTTGCAGCCGCTGTTATT
ACGACTCGCGCCCCCCGAGCCGGCCTGAACCTGCGGACTACCAGCCTGCTGCTCTACCTGCCGACGCCGGACTTT
AGCATGCCGTACAATGTCATCATCTTTACATCGACGGCCATTGCTCTGACGTTTGGCGGTTTGTATAATATCCTT
GTGCGGAGGTTGGTGGGCGCGGATGAGGCGCCAAATACGATGCTCAAGAACAAGGTGGGGAGGCTTTTGGGTCTG
CTGAAGGCTAGGCTGGGAGGGGGGAGTTGA
Gene >Ophio5|4005
ATGCGTCACCAACCGGTGCTTGTCCTCGCGAACCTCGTGGCCAGCCTCGTGACCCTCGCCGCGGCCGCATCTGAC
TATCACGAGCAGCTCACCTTGCGGCCGCTTCCACTATCAGCCCTTCTCGCGAGCTTCAACTTTCGGTCCAACACG
TCCCTCGCCGACTTTGATGCCCATCACTTTCGCCTCTTCCCAAGGTCGTTGGGCCAGATTCTGCAGCATTCTCGC
ACGCGCGAGCTGCATCTACGCTTCACCCTCGGCCGCTGGGATGCTGAGCGATGGGGTGCTAGACCTTGGGGAGGT
GCTCGTGAGGGCGGTACAGGTGTCGAGCTTTGGGCTTGGTTGGACAGAGACGCCGACGAGAACTGGCTGACGCTA
ACCAATGCCCTCTCCGGCCTCTTTTGTGCCTCACTCAACTTCATCGACTCGACGCGCACTACCCGCCCTGTCGTG
TCCTTTCAGCCCGAGGGTCATCATTCTGATTCCGCTCTCGGGACGACCAGCCTGCTGCATGGCGTTCTCCCGCAC
GAGGTCGTCTGCACCGAGAACCTGACGCCCTTCCTCAAGTTGCTGCCTTGCAAGGGCAAGGCCGGCATCGCCAGC
CTACTCGATGGACACAAGCTGTTTGACGCTTCGTTTCAGAGCATGGCCATTGACGTGAGGCCCATTTGTGACTCG
TCCGGCGTGTGTGTCCTTCAGATGGAGCAGACCATTGACATGGTACTGGATGTCGAACGCTCCAAGCGACCGAGA
GGTGCGTCCCCCTCCTTTGTCGTCATGACGTGGATTCGTAAAAAAACTAAACCTTTCCAATTCTTCCTCATTTCT
CCAGACAACCCCATCCCAAGACCACCTCCTAGCCAGGAGCTCCTCTGCGACATGTACAAGCCCTACAACGGCGAC
GGCTCCTGCTTCCCAACTGACCATCTTCATGGCCAGCACTGGGCGCTGTCTGAGATCTTTGGCCGCGCCATGAAG
GGCGTATGTCCCCTTTCCGACGGCACGCCCCCCGTTTGCCTTCAGGTGCCCGACTCTCGAGTCGTCTTCGTTTCC
GGCGCCTCGGGCGATATCAAGGACCCCAGTGGCATGTCGCGATGCTACTTGCCGGAAGACAACGGCGCTGAATTC
AACATCGAGCTCACCAAGCCCAGTGCAGTCGATGCGGCGGCATTCAAAGACTTGGTTCAGCCGGAGACGCCACTC
CTCTTTGCAGAGCGCAGTTTCATGGGCCACGGCCAGGAGCATGGTGGCGTCCAGGCCATCTTGACCAATCCTGGC
GACAACGAGGTTGAGTTTGTCTACATGGAGTCGCTGCCCTGGTTCATGCGCATCTACCTTCACACTCTCTCGACG
CGTATCTCATCGTCGTCCATCGCTACCAACGCTTCCTCACGGATCATAGAAGAGATCTATTACCGTCCAGCTCTT
GACCGCACCCGCGGCACTCAGCTCGAGCTCCTCATGCGCATCCCCCCTCGTTGCACCGTCTTCCTCACCTATGAT
TTCTCCAAGTCGATCCTCCGCTATACAGAGTATCCGCCAGACGCCAACCGCGGCTTCGACGTTGCAGCCGCTGTT
ATTACGACTCGCGCCCCCCGAGCCGGCCTGAACCTGCGGACTACCAGCCTGCTGCTCTACCTGCCGACGCCGGAC
TTTAGCATGCCGTACAATGTCATCATCTTTACATCGACGGCCATTGCTCTGACGTTTGGCGGTTTGTATAATATC
CTTGTGCGGAGGTTGGTGGGCGCGGATGAGGCGCCAAATACGATGCTCAAGAACAAGGTGGGGAGGCTTTTGGGT
CTGCTGAAGGCTAGGCTGGGAGGGGGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail