Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4004
Gene name
Locationscaffold_311:9894..10802
Strand-
Gene length (bp)908
Transcript length (bp)819
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03194 LUC7 LUC7 N_terminus 2.5E-65 4 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM4|LUC7_SCHPO U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp106 PE=1 SV=1 1 220 4.0E-60
sp|Q07508|LUC7_YEAST Protein LUC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LUC7 PE=1 SV=1 2 232 6.0E-50
sp|Q9NQ29|LUC7L_HUMAN Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens GN=LUC7L PE=1 SV=1 3 230 1.0E-37
sp|Q9CYI4|LUC7L_MOUSE Putative RNA-binding protein Luc7-like 1 OS=Mus musculus GN=Luc7l PE=1 SV=2 3 230 2.0E-37
sp|Q9Y383|LC7L2_HUMAN Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens GN=LUC7L2 PE=1 SV=2 3 228 5.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM4|LUC7_SCHPO U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp106 PE=1 SV=1 1 220 4.0E-60
sp|Q07508|LUC7_YEAST Protein LUC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LUC7 PE=1 SV=1 2 232 6.0E-50
sp|Q9NQ29|LUC7L_HUMAN Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens GN=LUC7L PE=1 SV=1 3 230 1.0E-37
sp|Q9CYI4|LUC7L_MOUSE Putative RNA-binding protein Luc7-like 1 OS=Mus musculus GN=Luc7l PE=1 SV=2 3 230 2.0E-37
sp|Q9Y383|LC7L2_HUMAN Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens GN=LUC7L2 PE=1 SV=2 3 228 5.0E-37
sp|Q7TNC4|LC7L2_MOUSE Putative RNA-binding protein Luc7-like 2 OS=Mus musculus GN=Luc7l2 PE=1 SV=1 3 228 1.0E-36
sp|Q5R8W6|LC7L3_PONAB Luc7-like protein 3 OS=Pongo abelii GN=LUC7L3 PE=2 SV=1 7 236 3.0E-25
sp|O95232|LC7L3_HUMAN Luc7-like protein 3 OS=Homo sapiens GN=LUC7L3 PE=1 SV=2 7 236 3.0E-25
sp|Q3SX41|LC7L3_BOVIN Luc7-like protein 3 OS=Bos taurus GN=LUC7L3 PE=2 SV=1 7 236 3.0E-25
sp|Q5SUF2|LC7L3_MOUSE Luc7-like protein 3 OS=Mus musculus GN=Luc7l3 PE=1 SV=1 7 236 4.0E-25
sp|Q09217|YP68_CAEEL Uncharacterized protein B0495.8 OS=Caenorhabditis elegans GN=B0495.8 PE=3 SV=1 1 223 1.0E-20
sp|Q54XQ8|LUC7L_DICDI Luc7-like protein OS=Dictyostelium discoideum GN=crop PE=3 SV=1 26 228 8.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0005685 U1 snRNP Yes
GO:0006376 mRNA splice site selection Yes
GO:0003729 mRNA binding Yes
GO:0005488 binding No
GO:0008150 biological_process No
GO:0022618 ribonucleoprotein complex assembly No
GO:0071826 ribonucleoprotein complex subunit organization No
GO:0032991 protein-containing complex No
GO:0003676 nucleic acid binding No
GO:1990904 ribonucleoprotein complex No
GO:0097525 spliceosomal snRNP complex No
GO:0120114 Sm-like protein family complex No
GO:0003674 molecular_function No
GO:0140513 nuclear protein-containing complex No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0030532 small nuclear ribonucleoprotein complex No
GO:0022607 cellular component assembly No
GO:0097159 organic cyclic compound binding No
GO:0043933 protein-containing complex organization No
GO:0065003 protein-containing complex assembly No
GO:0003723 RNA binding No
GO:0071840 cellular component organization or biogenesis No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4807 0.781 0.0926 0.0089 0.0699 0.0045 0.1678 0.0887 0.0851 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3684
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|967
Ophiocordyceps australis map64 (Brazil) OphauB2|7287
Ophiocordyceps camponoti-floridani Ophcf2|05396
Ophiocordyceps camponoti-rufipedis Ophun1|4348
Ophiocordyceps kimflemingae Ophio5|4004 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7125

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4004
MAAEQRKLLEQLMGSSSTSRDAQLSLDDAKVCRSHIVGTCPHDLFTNTKQDFGPCSKVHSEGLKAEFEALSDREK
QRLGFEYDYVRDLHKYIDDCNRRIDAAQRRLEKTPEEIRLTNDLLEALADIEENMKAGLLELRVYGEQDLVSIAL
DEWFHLKNLSQTKIEKERELKALSDTSGPSGHQKLQVCDVCGAYLSRLDNDRRLADHFYGKMHLGYAQMRKAYDS
FPKDMKSRVRQQPSMMMDGDGSSGPRGPKGSGGFRGYKGGGRNHRNG
Coding >Ophio5|4004
ATGGCGGCCGAGCAGAGAAAGCTGCTCGAGCAGCTCATGGGCAGTTCCTCGACCTCGCGTGACGCACAACTCTCG
CTCGACGACGCCAAAGTCTGCCGCTCGCACATCGTCGGCACATGCCCTCACGATCTCTTTACCAACACCAAGCAG
GACTTTGGTCCTTGCAGCAAGGTGCATTCCGAGGGTCTCAAGGCTGAGTTCGAGGCGCTCTCGGATCGCGAGAAG
CAGAGACTTGGCTTCGAGTACGACTACGTTCGCGATCTTCACAAGTACATCGACGACTGCAACCGCCGCATCGAC
GCCGCTCAGAGACGTCTGGAGAAGACGCCCGAGGAAATACGACTGACTAACGATCTGCTGGAGGCCCTTGCCGAC
ATAGAGGAAAATATGAAGGCTGGACTGCTTGAGCTCCGAGTCTACGGCGAGCAGGACCTCGTCTCCATCGCCCTC
GACGAGTGGTTTCACCTTAAAAACCTGAGCCAGACAAAGATCGAAAAAGAACGCGAGCTGAAGGCACTCTCCGAC
ACGTCGGGCCCTTCTGGTCACCAGAAGCTCCAAGTTTGCGACGTCTGCGGCGCCTACCTCAGCCGCCTCGACAAT
GATCGCCGACTGGCAGACCACTTCTACGGCAAGATGCACCTGGGCTACGCGCAGATGCGCAAGGCCTACGACTCA
TTCCCCAAGGATATGAAGAGCCGAGTGCGTCAGCAGCCTTCCATGATGATGGACGGAGACGGCTCTAGCGGCCCT
CGCGGGCCTAAAGGATCGGGTGGTTTCAGGGGCTACAAGGGCGGCGGCAGGAATCATCGCAATGGC
Transcript >Ophio5|4004
ATGGCGGCCGAGCAGAGAAAGCTGCTCGAGCAGCTCATGGGCAGTTCCTCGACCTCGCGTGACGCACAACTCTCG
CTCGACGACGCCAAAGTCTGCCGCTCGCACATCGTCGGCACATGCCCTCACGATCTCTTTACCAACACCAAGCAG
GACTTTGGTCCTTGCAGCAAGGTGCATTCCGAGGGTCTCAAGGCTGAGTTCGAGGCGCTCTCGGATCGCGAGAAG
CAGAGACTTGGCTTCGAGTACGACTACGTTCGCGATCTTCACAAGTACATCGACGACTGCAACCGCCGCATCGAC
GCCGCTCAGAGACGTCTGGAGAAGACGCCCGAGGAAATACGACTGACTAACGATCTGCTGGAGGCCCTTGCCGAC
ATAGAGGAAAATATGAAGGCTGGACTGCTTGAGCTCCGAGTCTACGGCGAGCAGGACCTCGTCTCCATCGCCCTC
GACGAGTGGTTTCACCTTAAAAACCTGAGCCAGACAAAGATCGAAAAAGAACGCGAGCTGAAGGCACTCTCCGAC
ACGTCGGGCCCTTCTGGTCACCAGAAGCTCCAAGTTTGCGACGTCTGCGGCGCCTACCTCAGCCGCCTCGACAAT
GATCGCCGACTGGCAGACCACTTCTACGGCAAGATGCACCTGGGCTACGCGCAGATGCGCAAGGCCTACGACTCA
TTCCCCAAGGATATGAAGAGCCGAGTGCGTCAGCAGCCTTCCATGATGATGGACGGAGACGGCTCTAGCGGCCCT
CGCGGGCCTAAAGGATCGGGTGGTTTCAGGGGCTACAAGGGCGGCGGCAGGAATCATCGCAATGGCTAG
Gene >Ophio5|4004
ATGGCGGCCGAGCAGAGAAAGCTGCTCGAGCAGCTCATGGGCAGTTCCTCGACCTCGCGTGACGCACAACTCTCG
CTCGACGACGCCAAAGTCTGCCGCTCGCACATCGTCGGCACATGCCCTCACGATCTCTTTACCAACACCAAGCAG
GACTTTGGTCCTTGCAGCAAGGTGCATTCCGAGGGTCTCAAGGCTGAGTTCGAGGCGCTCTCGGATCGCGAGAAG
CAGAGACTTGGCTTCGAGTACGACTACGTTCGCGATCTTCACAAGTACATCGACGACTGCAACCGCCGCATCGAC
GCCGCTCAGAGACGTCTGGAGAAGACGCCCGAGGAAATACGACTGACTAACGATCTGGTAAGCGACCAGTAATGA
TTCCGCTGATGTGATTTTATTCGCTCTCTTTCCCTATCATCTCGATACTGAATCTCTGCCATCACCCCCAGCTGG
AGGCCCTTGCCGACATAGAGGAAAATATGAAGGCTGGACTGCTTGAGCTCCGAGTCTACGGCGAGCAGGACCTCG
TCTCCATCGCCCTCGACGAGTGGTTTCACCTTAAAAACCTGAGCCAGACAAAGATCGAAAAAGAACGCGAGCTGA
AGGCACTCTCCGACACGTCGGGCCCTTCTGGTCACCAGAAGCTCCAAGTTTGCGACGTCTGCGGCGCCTACCTCA
GCCGCCTCGACAATGATCGCCGACTGGCAGACCACTTCTACGGCAAGATGCACCTGGGCTACGCGCAGATGCGCA
AGGCCTACGACTCATTCCCCAAGGATATGAAGAGCCGAGTGCGTCAGCAGCCTTCCATGATGATGGACGGAGACG
GCTCTAGCGGCCCTCGCGGGCCTAAAGGATCGGGTGGTTTCAGGGGCTACAAGGGCGGCGGCAGGAATCATCGCA
ATGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail