Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4001
Gene name
Locationscaffold_311:5645..6962
Strand+
Gene length (bp)1317
Transcript length (bp)1317
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 1.3E-09 147 297

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74467|SET5_SCHPO SET domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set5 PE=1 SV=1 130 398 2.0E-12

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4001
MASLSTLVSVVFFFVARSFGCLESQFGDLCTSSPLRRGWAQLDGILQRPLSSGALQSPLNEDPIPAASPSSPWSY
TGDCAQELGDESPTCVYANRSFANGRGISIITTPERAAYIAKTPAFLDSSILSHVNDYSSPPYEERELPGRGRGL
IANKTLRRGDVIFSSTPILILDSDSFEFEQDSVQEGQRYAAVVNLPSKTEMLFWGLYGQLWQDPITDRVNTNSFA
ADIDDENFSVVFPEIAVCCTSLTRDTRLLTKRQRLNHDCRPNAEYYFNSRTLTQDVVASTTIHPGTEITISYIDV
SQPRDKRVSQLANWGINCSCHACTRSATLTAASDARLAQISELDRNLSREIARPELPEKLLSLYKEEGLFGFLGA
AYRFAALSYCAEGQRSQAVKYAQMAFDSALSDNALNLDQALHMKRLAQRPEEQMCWQFRQRFE
Coding >Ophio5|4001
ATGGCGTCCTTGTCAACGCTCGTCAGCGTCGTTTTCTTCTTCGTTGCCCGCTCCTTTGGCTGCCTCGAGTCACAA
TTCGGAGACCTGTGCACCTCGTCTCCTCTTCGCCGCGGCTGGGCCCAGCTAGACGGCATTCTTCAACGTCCACTA
AGCTCGGGAGCTTTACAAAGTCCACTGAACGAGGATCCTATCCCTGCTGCCTCGCCGTCATCTCCGTGGTCTTAC
ACGGGTGACTGCGCCCAAGAATTGGGCGACGAATCTCCAACTTGTGTCTACGCCAACAGGTCTTTCGCCAATGGA
CGCGGCATTTCTATCATCACCACACCCGAGCGTGCGGCATATATAGCCAAAACGCCGGCCTTTCTCGACTCAAGC
ATCTTGTCCCACGTTAACGATTACTCGTCGCCGCCGTACGAGGAGAGAGAGTTGCCTGGTCGGGGACGAGGTCTC
ATTGCCAACAAGACATTACGTCGTGGCGATGTCATCTTTTCTAGCACGCCTATCTTGATTCTCGATTCGGATAGT
TTCGAATTTGAACAGGATAGCGTGCAAGAGGGACAGCGCTATGCTGCCGTCGTTAACCTGCCCTCCAAGACGGAG
ATGCTGTTTTGGGGCTTGTACGGTCAACTGTGGCAGGATCCCATCACCGATCGCGTTAATACAAATTCGTTTGCG
GCCGACATTGACGACGAGAACTTCTCTGTCGTCTTTCCAGAGATTGCTGTATGCTGCACAAGTCTTACTCGGGAT
ACCCGTTTGCTAACGAAGAGGCAGCGGCTCAACCATGACTGTCGTCCAAACGCCGAGTATTACTTCAACTCCCGC
ACCCTCACACAGGATGTAGTTGCCAGCACGACCATCCACCCCGGCACCGAAATCACAATCTCCTACATTGACGTG
AGCCAGCCGCGAGATAAGCGCGTCTCGCAACTGGCAAACTGGGGCATCAACTGCTCCTGCCACGCCTGCACCCGA
TCTGCAACGTTGACCGCGGCATCCGATGCACGACTCGCTCAGATCTCCGAACTGGATAGGAATCTTTCCCGCGAA
ATAGCCCGTCCTGAGTTGCCGGAGAAGCTCCTCAGTCTCTACAAGGAAGAAGGTCTCTTTGGATTCCTCGGCGCG
GCGTATCGCTTCGCGGCGCTTTCGTATTGCGCTGAGGGACAGCGGTCCCAAGCGGTCAAGTATGCGCAGATGGCA
TTTGACTCTGCGCTTTCGGATAATGCGCTTAACCTCGATCAGGCGCTTCACATGAAGCGGTTGGCCCAGAGGCCG
GAGGAGCAGATGTGTTGGCAGTTTCGGCAGCGGTTCGAA
Transcript >Ophio5|4001
ATGGCGTCCTTGTCAACGCTCGTCAGCGTCGTTTTCTTCTTCGTTGCCCGCTCCTTTGGCTGCCTCGAGTCACAA
TTCGGAGACCTGTGCACCTCGTCTCCTCTTCGCCGCGGCTGGGCCCAGCTAGACGGCATTCTTCAACGTCCACTA
AGCTCGGGAGCTTTACAAAGTCCACTGAACGAGGATCCTATCCCTGCTGCCTCGCCGTCATCTCCGTGGTCTTAC
ACGGGTGACTGCGCCCAAGAATTGGGCGACGAATCTCCAACTTGTGTCTACGCCAACAGGTCTTTCGCCAATGGA
CGCGGCATTTCTATCATCACCACACCCGAGCGTGCGGCATATATAGCCAAAACGCCGGCCTTTCTCGACTCAAGC
ATCTTGTCCCACGTTAACGATTACTCGTCGCCGCCGTACGAGGAGAGAGAGTTGCCTGGTCGGGGACGAGGTCTC
ATTGCCAACAAGACATTACGTCGTGGCGATGTCATCTTTTCTAGCACGCCTATCTTGATTCTCGATTCGGATAGT
TTCGAATTTGAACAGGATAGCGTGCAAGAGGGACAGCGCTATGCTGCCGTCGTTAACCTGCCCTCCAAGACGGAG
ATGCTGTTTTGGGGCTTGTACGGTCAACTGTGGCAGGATCCCATCACCGATCGCGTTAATACAAATTCGTTTGCG
GCCGACATTGACGACGAGAACTTCTCTGTCGTCTTTCCAGAGATTGCTGTATGCTGCACAAGTCTTACTCGGGAT
ACCCGTTTGCTAACGAAGAGGCAGCGGCTCAACCATGACTGTCGTCCAAACGCCGAGTATTACTTCAACTCCCGC
ACCCTCACACAGGATGTAGTTGCCAGCACGACCATCCACCCCGGCACCGAAATCACAATCTCCTACATTGACGTG
AGCCAGCCGCGAGATAAGCGCGTCTCGCAACTGGCAAACTGGGGCATCAACTGCTCCTGCCACGCCTGCACCCGA
TCTGCAACGTTGACCGCGGCATCCGATGCACGACTCGCTCAGATCTCCGAACTGGATAGGAATCTTTCCCGCGAA
ATAGCCCGTCCTGAGTTGCCGGAGAAGCTCCTCAGTCTCTACAAGGAAGAAGGTCTCTTTGGATTCCTCGGCGCG
GCGTATCGCTTCGCGGCGCTTTCGTATTGCGCTGAGGGACAGCGGTCCCAAGCGGTCAAGTATGCGCAGATGGCA
TTTGACTCTGCGCTTTCGGATAATGCGCTTAACCTCGATCAGGCGCTTCACATGAAGCGGTTGGCCCAGAGGCCG
GAGGAGCAGATGTGTTGGCAGTTTCGGCAGCGGTTCGAATAG
Gene >Ophio5|4001
ATGGCGTCCTTGTCAACGCTCGTCAGCGTCGTTTTCTTCTTCGTTGCCCGCTCCTTTGGCTGCCTCGAGTCACAA
TTCGGAGACCTGTGCACCTCGTCTCCTCTTCGCCGCGGCTGGGCCCAGCTAGACGGCATTCTTCAACGTCCACTA
AGCTCGGGAGCTTTACAAAGTCCACTGAACGAGGATCCTATCCCTGCTGCCTCGCCGTCATCTCCGTGGTCTTAC
ACGGGTGACTGCGCCCAAGAATTGGGCGACGAATCTCCAACTTGTGTCTACGCCAACAGGTCTTTCGCCAATGGA
CGCGGCATTTCTATCATCACCACACCCGAGCGTGCGGCATATATAGCCAAAACGCCGGCCTTTCTCGACTCAAGC
ATCTTGTCCCACGTTAACGATTACTCGTCGCCGCCGTACGAGGAGAGAGAGTTGCCTGGTCGGGGACGAGGTCTC
ATTGCCAACAAGACATTACGTCGTGGCGATGTCATCTTTTCTAGCACGCCTATCTTGATTCTCGATTCGGATAGT
TTCGAATTTGAACAGGATAGCGTGCAAGAGGGACAGCGCTATGCTGCCGTCGTTAACCTGCCCTCCAAGACGGAG
ATGCTGTTTTGGGGCTTGTACGGTCAACTGTGGCAGGATCCCATCACCGATCGCGTTAATACAAATTCGTTTGCG
GCCGACATTGACGACGAGAACTTCTCTGTCGTCTTTCCAGAGATTGCTGTATGCTGCACAAGTCTTACTCGGGAT
ACCCGTTTGCTAACGAAGAGGCAGCGGCTCAACCATGACTGTCGTCCAAACGCCGAGTATTACTTCAACTCCCGC
ACCCTCACACAGGATGTAGTTGCCAGCACGACCATCCACCCCGGCACCGAAATCACAATCTCCTACATTGACGTG
AGCCAGCCGCGAGATAAGCGCGTCTCGCAACTGGCAAACTGGGGCATCAACTGCTCCTGCCACGCCTGCACCCGA
TCTGCAACGTTGACCGCGGCATCCGATGCACGACTCGCTCAGATCTCCGAACTGGATAGGAATCTTTCCCGCGAA
ATAGCCCGTCCTGAGTTGCCGGAGAAGCTCCTCAGTCTCTACAAGGAAGAAGGTCTCTTTGGATTCCTCGGCGCG
GCGTATCGCTTCGCGGCGCTTTCGTATTGCGCTGAGGGACAGCGGTCCCAAGCGGTCAAGTATGCGCAGATGGCA
TTTGACTCTGCGCTTTCGGATAATGCGCTTAACCTCGATCAGGCGCTTCACATGAAGCGGTTGGCCCAGAGGCCG
GAGGAGCAGATGTGTTGGCAGTTTCGGCAGCGGTTCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail