Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|400
Gene name
Locationscaffold_11:383..2935
Strand-
Gene length (bp)2552
Transcript length (bp)2439
Coding sequence length (bp)2436
Protein length (aa) 812

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.0E-04 495 625

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|400
MMIVLPLWLLSLRSVLAIPTTEKTPEPEKAEALLPFPQPAAGVVFVFFASTYLSPLEIYSRTGYPLPAGYENFDS
SFNVSLTAVNAPPPGAFIALWRSPNLALQHVPGARFLYQVHCSENMLDFSEEIWILGGLNVSQIIGHYELPSGDE
DYEIPWANLAHLHLHDNAYYNEGWWWGHRMTAFDPRYWNVAEPRMSAKLFMESLTGEARRAIGWTGQFPLPFQSR
QPLTPVHTLAPRPHGASAFSDDDYSYTYYLSTDEDGEYPEPPKKKVVASKDLVYSDKEQQAGTSRAAQDLRDSEE
AGPSSAGDSRTAPDVAGDSRTAPDVAGVPPAGVVSPSVHQEDYDEYNIFDAADRAALEHLAQAGQMNPARCLTIL
AELILLMKGSGRQRSELKRRWLPPVAEEALNSTPVPTTADNDHCAKLKKKLKLAREKPELLHQRSEPIHGPLPMP
DIYNLSSVYGADFALIRSNFSATTAEELGYLPAPAFDGIRQYKADWSIYNHYHGQTQKHESSAYLAATRDTDRGL
NRNRHPDGATFIYVAQMTDNFIPVGTTLRIKQPEEYAVARHVSMRLIHGWMNLTSGHYVRNKAFVSLGFSAMPAP
AQPQLAGFPMASKSWTYPAFHRFGRACLFVDTEGSEPSVEATKEALESCTRDTQLGVLERHGQAFLNRLPCVALE
QLAMYMEIGGDGTSETVWAIFPHDTVRMFEEARAEARQWRNIDLELAYRKGAVLLAEMGNLGIMCSSENWHDSWT
LKSLKLRGKCVHPRPPVEYRDYENMEAEFQNTDGVNRVVWEETLLASRWVNCPGCQVLHPLS
Coding >Ophio5|400
ATGATGATCGTCTTGCCCCTTTGGCTCCTCAGCCTGAGATCCGTCCTGGCCATTCCGACGACTGAGAAGACTCCG
GAGCCTGAGAAGGCTGAGGCGCTTTTGCCGTTTCCGCAGCCTGCAGCGGGAGTAGTCTTCGTTTTTTTTGCGTCT
ACCTATCTGTCTCCCCTCGAGATCTACAGCCGAACAGGATACCCGCTTCCAGCCGGCTATGAGAACTTTGATAGT
TCATTCAATGTTTCGCTGACGGCCGTGAACGCGCCGCCACCCGGAGCCTTCATCGCGCTTTGGCGTTCGCCAAAC
CTGGCGTTGCAGCACGTCCCAGGCGCGCGATTCCTGTACCAGGTCCATTGCTCGGAGAATATGCTGGACTTTTCC
GAGGAGATTTGGATCCTGGGAGGCCTTAACGTATCACAGATTATAGGTCATTATGAGTTGCCGAGTGGTGACGAG
GACTATGAGATACCATGGGCCAACCTCGCACATCTCCATCTCCATGACAACGCTTATTACAACGAGGGATGGTGG
TGGGGGCACCGTATGACGGCCTTCGATCCCAGGTACTGGAACGTGGCCGAACCGAGGATGTCGGCCAAGCTCTTC
ATGGAAAGCCTGACGGGTGAGGCCCGTCGCGCCATCGGCTGGACCGGACAATTCCCGCTGCCGTTTCAGTCACGG
CAGCCTCTGACGCCGGTGCACACTTTGGCACCGCGGCCTCATGGTGCCAGCGCCTTTTCGGACGACGACTACTCC
TACACCTATTACCTGTCGACGGACGAGGATGGCGAGTACCCGGAGCCGCCGAAGAAGAAGGTTGTGGCGAGCAAG
GACCTGGTGTACTCTGACAAGGAGCAACAAGCCGGAACATCGAGGGCGGCACAAGATCTGCGTGACAGCGAAGAA
GCAGGACCGTCCAGTGCCGGTGATTCGCGGACAGCACCGGACGTCGCCGGTGATTCGCGGACAGCACCGGACGTC
GCCGGGGTGCCACCTGCGGGGGTTGTCTCGCCGTCGGTCCACCAAGAAGACTACGACGAATACAACATCTTCGAT
GCCGCCGACCGCGCCGCCCTAGAGCACTTGGCCCAAGCTGGCCAGATGAACCCAGCCCGTTGCTTGACGATCCTT
GCCGAACTCATCCTCCTCATGAAGGGTAGCGGCCGTCAAAGGAGCGAGCTCAAAAGAAGATGGCTTCCGCCCGTT
GCGGAGGAGGCGCTGAACTCTACGCCCGTCCCTACGACAGCCGACAACGATCACTGCGCGAAGCTCAAGAAGAAA
CTGAAGCTGGCCAGAGAGAAGCCCGAGCTGCTTCATCAGAGGTCGGAGCCGATTCACGGGCCGTTGCCAATGCCC
GACATCTACAATCTGTCGTCGGTATACGGTGCCGACTTCGCCCTCATCCGCAGCAACTTCTCGGCCACGACAGCC
GAAGAGCTGGGATACCTCCCGGCGCCGGCCTTTGACGGCATCAGGCAATACAAGGCCGACTGGTCCATCTACAAC
CATTACCACGGCCAGACGCAAAAGCACGAGTCGTCGGCCTACCTCGCCGCGACACGCGACACTGACCGCGGCCTC
AACCGCAACCGGCATCCGGACGGGGCCACTTTCATCTACGTGGCGCAGATGACGGACAACTTCATCCCCGTCGGG
ACGACGCTCCGAATCAAGCAGCCAGAGGAGTACGCGGTGGCGCGTCACGTCTCCATGCGCCTGATCCACGGTTGG
ATGAACCTGACGAGCGGCCACTACGTCCGCAACAAGGCCTTCGTCTCCCTCGGCTTCTCCGCCATGCCTGCGCCG
GCCCAGCCGCAACTGGCCGGCTTCCCGATGGCGTCAAAGTCTTGGACGTACCCGGCGTTCCACAGGTTCGGCCGG
GCCTGTCTCTTCGTCGACACAGAGGGCTCGGAGCCGTCGGTGGAGGCGACGAAGGAGGCGCTCGAAAGCTGCACG
CGCGACACGCAGCTCGGGGTGCTGGAGCGACACGGCCAGGCCTTCCTCAACAGGCTGCCTTGCGTCGCCCTCGAG
CAGCTCGCCATGTACATGGAGATTGGCGGCGACGGCACGAGCGAGACGGTCTGGGCCATCTTCCCACACGATACG
GTCCGCATGTTTGAAGAGGCGAGGGCCGAGGCTAGACAGTGGCGGAATATTGACCTCGAGCTTGCCTATCGAAAG
GGTGCCGTCCTCTTGGCTGAAATGGGGAACCTCGGGATTATGTGTTCCAGTGAGAATTGGCACGACTCGTGGACG
CTCAAGAGTCTGAAACTGCGTGGCAAATGCGTCCATCCCCGGCCGCCGGTCGAGTATCGCGACTACGAGAACATG
GAGGCCGAGTTCCAGAACACGGATGGCGTCAACCGGGTCGTGTGGGAAGAGACACTGCTGGCCTCGCGCTGGGTG
AATTGTCCGGGCTGTCAGGTCCTGCATCCGCTTTCG
Transcript >Ophio5|400
ATGATGATCGTCTTGCCCCTTTGGCTCCTCAGCCTGAGATCCGTCCTGGCCATTCCGACGACTGAGAAGACTCCG
GAGCCTGAGAAGGCTGAGGCGCTTTTGCCGTTTCCGCAGCCTGCAGCGGGAGTAGTCTTCGTTTTTTTTGCGTCT
ACCTATCTGTCTCCCCTCGAGATCTACAGCCGAACAGGATACCCGCTTCCAGCCGGCTATGAGAACTTTGATAGT
TCATTCAATGTTTCGCTGACGGCCGTGAACGCGCCGCCACCCGGAGCCTTCATCGCGCTTTGGCGTTCGCCAAAC
CTGGCGTTGCAGCACGTCCCAGGCGCGCGATTCCTGTACCAGGTCCATTGCTCGGAGAATATGCTGGACTTTTCC
GAGGAGATTTGGATCCTGGGAGGCCTTAACGTATCACAGATTATAGGTCATTATGAGTTGCCGAGTGGTGACGAG
GACTATGAGATACCATGGGCCAACCTCGCACATCTCCATCTCCATGACAACGCTTATTACAACGAGGGATGGTGG
TGGGGGCACCGTATGACGGCCTTCGATCCCAGGTACTGGAACGTGGCCGAACCGAGGATGTCGGCCAAGCTCTTC
ATGGAAAGCCTGACGGGTGAGGCCCGTCGCGCCATCGGCTGGACCGGACAATTCCCGCTGCCGTTTCAGTCACGG
CAGCCTCTGACGCCGGTGCACACTTTGGCACCGCGGCCTCATGGTGCCAGCGCCTTTTCGGACGACGACTACTCC
TACACCTATTACCTGTCGACGGACGAGGATGGCGAGTACCCGGAGCCGCCGAAGAAGAAGGTTGTGGCGAGCAAG
GACCTGGTGTACTCTGACAAGGAGCAACAAGCCGGAACATCGAGGGCGGCACAAGATCTGCGTGACAGCGAAGAA
GCAGGACCGTCCAGTGCCGGTGATTCGCGGACAGCACCGGACGTCGCCGGTGATTCGCGGACAGCACCGGACGTC
GCCGGGGTGCCACCTGCGGGGGTTGTCTCGCCGTCGGTCCACCAAGAAGACTACGACGAATACAACATCTTCGAT
GCCGCCGACCGCGCCGCCCTAGAGCACTTGGCCCAAGCTGGCCAGATGAACCCAGCCCGTTGCTTGACGATCCTT
GCCGAACTCATCCTCCTCATGAAGGGTAGCGGCCGTCAAAGGAGCGAGCTCAAAAGAAGATGGCTTCCGCCCGTT
GCGGAGGAGGCGCTGAACTCTACGCCCGTCCCTACGACAGCCGACAACGATCACTGCGCGAAGCTCAAGAAGAAA
CTGAAGCTGGCCAGAGAGAAGCCCGAGCTGCTTCATCAGAGGTCGGAGCCGATTCACGGGCCGTTGCCAATGCCC
GACATCTACAATCTGTCGTCGGTATACGGTGCCGACTTCGCCCTCATCCGCAGCAACTTCTCGGCCACGACAGCC
GAAGAGCTGGGATACCTCCCGGCGCCGGCCTTTGACGGCATCAGGCAATACAAGGCCGACTGGTCCATCTACAAC
CATTACCACGGCCAGACGCAAAAGCACGAGTCGTCGGCCTACCTCGCCGCGACACGCGACACTGACCGCGGCCTC
AACCGCAACCGGCATCCGGACGGGGCCACTTTCATCTACGTGGCGCAGATGACGGACAACTTCATCCCCGTCGGG
ACGACGCTCCGAATCAAGCAGCCAGAGGAGTACGCGGTGGCGCGTCACGTCTCCATGCGCCTGATCCACGGTTGG
ATGAACCTGACGAGCGGCCACTACGTCCGCAACAAGGCCTTCGTCTCCCTCGGCTTCTCCGCCATGCCTGCGCCG
GCCCAGCCGCAACTGGCCGGCTTCCCGATGGCGTCAAAGTCTTGGACGTACCCGGCGTTCCACAGGTTCGGCCGG
GCCTGTCTCTTCGTCGACACAGAGGGCTCGGAGCCGTCGGTGGAGGCGACGAAGGAGGCGCTCGAAAGCTGCACG
CGCGACACGCAGCTCGGGGTGCTGGAGCGACACGGCCAGGCCTTCCTCAACAGGCTGCCTTGCGTCGCCCTCGAG
CAGCTCGCCATGTACATGGAGATTGGCGGCGACGGCACGAGCGAGACGGTCTGGGCCATCTTCCCACACGATACG
GTCCGCATGTTTGAAGAGGCGAGGGCCGAGGCTAGACAGTGGCGGAATATTGACCTCGAGCTTGCCTATCGAAAG
GGTGCCGTCCTCTTGGCTGAAATGGGGAACCTCGGGATTATGTGTTCCAGTGAGAATTGGCACGACTCGTGGACG
CTCAAGAGTCTGAAACTGCGTGGCAAATGCGTCCATCCCCGGCCGCCGGTCGAGTATCGCGACTACGAGAACATG
GAGGCCGAGTTCCAGAACACGGATGGCGTCAACCGGGTCGTGTGGGAAGAGACACTGCTGGCCTCGCGCTGGGTG
AATTGTCCGGGCTGTCAGGTCCTGCATCCGCTTTCGTAG
Gene >Ophio5|400
ATGATGATCGTCTTGCCCCTTTGGCTCCTCAGCCTGAGATCCGTCCTGGCCATTCCGACGACTGAGAAGACTCCG
GAGCCTGAGAAGGCTGAGGCGCTTTTGCCGTTTCCGCAGCCTGCAGCGGGAGTAGTCTTCGTTTTTTTTGCGTCT
ACCTATCTGTCTCCCCTCGAGATCTACAGCCGAACAGGATACCCGCTTCCAGCCGGCTATGAGAACTTTGATAGT
TCATTCAATGTTTCGCTGACGGCCGTGAACGCGCCGCCACCCGGAGCCTTCATCGCGCTTTGGCGTTCGCCAAAC
CTGGCGTTGCAGCACGTCCCAGGCGCGCGATTCCTGTACCAGGTCCATTGCTCGGAGAATATGCTGGACTTTTCC
GAGGAGATTTGGATCCTGGGAGGCCTTAACGTATCACAGATTATAGGTCATTATGAGTTGCCGAGTGGTGACGAG
GACTATGAGATACCATGGGCCAACCTCGCACATCTCCATCTCCATGACAACGCTTATTACAACGAGGGATGGTGG
TGGGGGCACCGTATGACGGCCTTCGATCCCAGGTACTGGAACGTGGCCGAACCGAGGATGTCGGCCAAGCTCTTC
ATGGAAAGCCTGACGGGTGAGGCCCGTCGCGCCATCGGCTGGACCGGACAATTCCCGCTGCCGTTTCAGTCACGG
CAGCCTCTGACGCCGGTGCACACTTTGGCACCGCGGCCTCATGGTGCCAGCGCCTTTTCGGACGACGACTACTCC
TACACCTATTACCTGTCGACGGACGAGGATGGCGAGTACCCGGAGCCGCCGAAGAAGAAGGTTGTGGCGAGCAAG
GACCTGGTGTACTCTGACAAGGAGCAACAAGCCGGAACATCGAGGGCGGCACAAGATCTGCGTGACAGCGAAGAA
GCAGGACCGTCCAGTGCCGGTGATTCGCGGACAGCACCGGACGTCGCCGGTGATTCGCGGACAGCACCGGACGTC
GCCGGGGTGCCACCTGCGGGGGTTGTCTCGCCGTCGGTCCACCAAGAAGACTACGACGAATACAACATCTTCGAT
GCCGCCGACCGCGCCGCCCTAGAGCACTTGGCCCAAGCTGGCCAGATGAACCCAGCCCGTTGCTTGACGATCCTT
GCCGAACTCATCCTCCTCATGAAGGGTAGCGGCCGTCAAAGGAGCGAGCTCAAAAGAAGATGGCTTCCGCCCGTT
GCGGAGGAGGCGCTGAACTCTACGCGTCAGTATTTGTTCAAGTGACATGACACACACACTGACTCTCGGCAGCCG
TCCCTACGACAGCCGACAACGATCACTGCGCGAAGCTCAAGAAGAAACTGAAGCTGGCCAGAGAGAAGCCCGAGC
TGCTTCATCAGAGGTCGGAGCCGATTCACGGGCCGTTGCCAATGCCCGACATCTACAATCTGTCGTCGGTATACG
GTGCCGACTTCGCCCTCATCCGCAGCAACTTCTCGGCCACGACAGCCGAAGAGCTGGGATACCTCCCGGCGCCGG
CCTTTGACGGCATCAGGCAATACAAGGCCGACTGGTCCATCTACAACCATTACCACGGCCAGACGCAAAAGCACG
AGTCGTCGGCCTACCTCGCCGCGACACGCGACACTGACCGCGGCCTCAACCGCAACCGGCATCCGGACGGGGCCA
CTTTCATCTACGTGGCGCAGATGACGGACAACTTCATCCCCGTCGGGACGACGCTCCGAATCAAGCAGCCAGAGG
AGTACGCGGTGGCGCGTCACGTCTCCATGCGCCTGATCCACGGTTGGATGAACCTGACGAGCGGCCACTACGTCC
GCAACAAGGCCTTCGTCTCCCTCGGCTTCTCCGCCATGCCTGCGCCGGCCCAGCCGCAACTGGCCGGCTTCCCGA
TGGCGTCAAAGTCTTGGACGTACCCGGCGTTCCACAGGTTCGGCCGGGCCTGTCTCTTCGTCGACACAGAGGGCT
CGGAGCCGTCGGTGGAGGCGACGAAGGAGGCGCTCGAAAGCTGCACGCGCGACACGCAGCTCGGGGTGCTGGAGC
GACACGGCCAGGCCTTCCTCAACAGGCTGCCTTGCGTCGCCCTCGAGCAGCTCGCCATGTACATGGAGATTGGCG
GCGACGGCACGAGCGAGACGGTCTGGGCCATCTTCCCACACGATACGGTCCGCATGTTTGAAGAGGCGAGGGCCG
AGGCTAGACAGTGGCGGAATATTGACCTCGAGCTTGCCTATCGAAAGGGTGCCGTCCTCTTGGCTGAAATGGGGA
ACCTCGGGATTATGTGTTCCAGTGAGAATTGGCACGACTCGTGGACGCTCAAGAGTAAGTGTTTTTTTCCCGTCT
TTCTTCTTTCTTTTTTAATTTTTTTCTCTTTTCTCACTCTTCCAGGTCTGAAACTGCGTGGCAAATGCGTCCATC
CCCGGCCGCCGGTCGAGTATCGCGACTACGAGAACATGGAGGCCGAGTTCCAGAACACGGATGGCGTCAACCGGG
TCGTGTGGGAAGAGACACTGCTGGCCTCGCGCTGGGTGAATTGTCCGGGCTGTCAGGTCCTGCATCCGCTTTCGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail