Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3984
Gene name
Locationscaffold_31:57812..59350
Strand+
Gene length (bp)1538
Transcript length (bp)1473
Coding sequence length (bp)1470
Protein length (aa) 490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 7.9E-16 210 277
PF08544 GHMP_kinases_C GHMP kinases C terminal 2.0E-07 387 446

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P24521|ERG8_YEAST Phosphomevalonate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG8 PE=1 SV=2 60 481 7.0E-72
sp|Q9UT88|ERG8_SCHPO Probable phosphomevalonate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg8 PE=3 SV=1 59 481 6.0E-64
sp|Q97UL6|PMK_SULSO Phosphomevalonate kinase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2988 PE=1 SV=1 211 481 5.0E-11

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 38.16 20.07 56.25
CcL In ants, during behavior modification 53.67 28.01 79.33
CcD In ants, recently dead 49.35 26.85 71.85

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.154608 no
SC16a CcD 0.287388 no
CcL CcD 0.760111 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3984
MRLCAKLLLLFPLLSSPLLHDPSRQSLKGICSVTFEPSSTVFSPQNKAGPMPTPQRPTVAVSAPGKVLLTGGYLV
LDREHTGLVSGLSARINVVAGEITTGQGVQLSEMVVDSPQFLDAQWRYGYHLAAEGGGIKVTQLQVISRNKFVET
TLSFVLTYINHVALSSSGRGIGSARLIILADNDYYSQTPSAAFDARGRFAKFTVPLTRAHKTGLGSSAALVTAIA
ASLLCHYLPEDRFDVSTTKGRATLHNLAQAAHCAAQGKVGSGFDVAAAVYGSCVYRRFSPHVLSRLPAPGEAGFS
DSLAAVVDGGWDVEIDSGGMRIPDGLTLHMCDVDGGTQSVGMAKKVLSWRSRHPETCSELWQRLQTANDALADHL
RSGTVDQLPDAIRAIRVLLRDMGKLSDVPIEPESQTELLDAVSAVDGVYGGVVPGAGGFDALALLARDDDATRER
LDARLSLWSEQKNTSVRLLGVRSETDGVRSEDLDVYAGWL
Coding >Ophio5|3984
ATGCGACTCTGCGCAAAGCTTCTCCTTCTCTTTCCTCTCCTCTCCTCTCCTCTCCTACATGACCCATCTCGTCAG
TCCCTCAAAGGCATTTGTTCGGTGACTTTTGAACCGTCATCTACCGTCTTCTCACCCCAAAACAAGGCCGGCCCA
ATGCCGACTCCACAACGTCCGACAGTTGCCGTCTCGGCGCCGGGCAAGGTGCTGCTCACGGGCGGCTACCTGGTG
CTCGACCGGGAGCACACCGGGCTGGTGTCGGGGCTCAGCGCACGAATCAACGTGGTGGCGGGCGAGATCACGACA
GGCCAGGGCGTACAGCTGAGCGAGATGGTCGTCGACAGCCCGCAGTTCCTCGACGCGCAGTGGCGCTATGGGTAC
CATCTCGCGGCCGAGGGAGGCGGCATCAAGGTGACGCAGCTACAGGTAATCTCGCGTAACAAGTTTGTCGAGACG
ACGTTGAGTTTTGTTCTGACCTATATCAATCACGTCGCCCTGTCGTCTTCGGGGAGAGGCATCGGCTCGGCTCGG
CTCATCATACTGGCCGACAATGACTATTATTCGCAGACGCCTTCTGCCGCATTCGATGCTCGTGGTCGCTTCGCC
AAGTTCACCGTTCCGCTGACGAGGGCACATAAGACGGGGCTCGGCTCTTCGGCTGCTCTCGTCACCGCCATCGCC
GCCTCTCTGCTGTGTCATTACCTGCCGGAGGACAGATTCGACGTGTCGACGACGAAGGGTCGGGCCACGTTGCAT
AATCTGGCTCAGGCCGCTCACTGCGCTGCCCAGGGGAAAGTGGGCTCTGGCTTCGACGTCGCCGCCGCCGTCTAC
GGCTCCTGTGTCTACCGCCGCTTCTCCCCGCATGTGCTGAGCCGGCTGCCGGCGCCCGGTGAGGCCGGCTTTAGC
GATAGCTTGGCGGCTGTCGTCGACGGCGGCTGGGATGTGGAGATTGACTCTGGCGGGATGCGTATACCCGACGGC
CTGACGCTGCACATGTGCGACGTCGACGGCGGCACCCAGTCGGTCGGTATGGCGAAGAAGGTCTTGTCCTGGAGA
AGCCGCCATCCCGAGACCTGCAGCGAGCTCTGGCAGCGGCTCCAGACGGCCAACGACGCGCTTGCGGATCATCTC
CGCAGCGGGACTGTCGATCAGCTTCCCGATGCCATCCGCGCCATTCGCGTTCTGCTTCGTGATATGGGCAAGCTC
AGCGACGTGCCCATCGAGCCCGAGTCTCAGACGGAGCTGCTCGACGCCGTCAGCGCCGTCGACGGCGTCTACGGA
GGCGTCGTCCCCGGTGCTGGCGGTTTCGACGCCCTAGCCTTACTGGCTCGCGACGACGACGCGACGAGGGAACGC
CTCGACGCCCGTCTCTCCCTGTGGAGTGAGCAAAAGAATACCTCGGTCCGGCTCCTGGGCGTCAGGAGCGAGACG
GACGGGGTGCGGTCGGAAGACCTGGACGTCTACGCCGGCTGGCTA
Transcript >Ophio5|3984
ATGCGACTCTGCGCAAAGCTTCTCCTTCTCTTTCCTCTCCTCTCCTCTCCTCTCCTACATGACCCATCTCGTCAG
TCCCTCAAAGGCATTTGTTCGGTGACTTTTGAACCGTCATCTACCGTCTTCTCACCCCAAAACAAGGCCGGCCCA
ATGCCGACTCCACAACGTCCGACAGTTGCCGTCTCGGCGCCGGGCAAGGTGCTGCTCACGGGCGGCTACCTGGTG
CTCGACCGGGAGCACACCGGGCTGGTGTCGGGGCTCAGCGCACGAATCAACGTGGTGGCGGGCGAGATCACGACA
GGCCAGGGCGTACAGCTGAGCGAGATGGTCGTCGACAGCCCGCAGTTCCTCGACGCGCAGTGGCGCTATGGGTAC
CATCTCGCGGCCGAGGGAGGCGGCATCAAGGTGACGCAGCTACAGGTAATCTCGCGTAACAAGTTTGTCGAGACG
ACGTTGAGTTTTGTTCTGACCTATATCAATCACGTCGCCCTGTCGTCTTCGGGGAGAGGCATCGGCTCGGCTCGG
CTCATCATACTGGCCGACAATGACTATTATTCGCAGACGCCTTCTGCCGCATTCGATGCTCGTGGTCGCTTCGCC
AAGTTCACCGTTCCGCTGACGAGGGCACATAAGACGGGGCTCGGCTCTTCGGCTGCTCTCGTCACCGCCATCGCC
GCCTCTCTGCTGTGTCATTACCTGCCGGAGGACAGATTCGACGTGTCGACGACGAAGGGTCGGGCCACGTTGCAT
AATCTGGCTCAGGCCGCTCACTGCGCTGCCCAGGGGAAAGTGGGCTCTGGCTTCGACGTCGCCGCCGCCGTCTAC
GGCTCCTGTGTCTACCGCCGCTTCTCCCCGCATGTGCTGAGCCGGCTGCCGGCGCCCGGTGAGGCCGGCTTTAGC
GATAGCTTGGCGGCTGTCGTCGACGGCGGCTGGGATGTGGAGATTGACTCTGGCGGGATGCGTATACCCGACGGC
CTGACGCTGCACATGTGCGACGTCGACGGCGGCACCCAGTCGGTCGGTATGGCGAAGAAGGTCTTGTCCTGGAGA
AGCCGCCATCCCGAGACCTGCAGCGAGCTCTGGCAGCGGCTCCAGACGGCCAACGACGCGCTTGCGGATCATCTC
CGCAGCGGGACTGTCGATCAGCTTCCCGATGCCATCCGCGCCATTCGCGTTCTGCTTCGTGATATGGGCAAGCTC
AGCGACGTGCCCATCGAGCCCGAGTCTCAGACGGAGCTGCTCGACGCCGTCAGCGCCGTCGACGGCGTCTACGGA
GGCGTCGTCCCCGGTGCTGGCGGTTTCGACGCCCTAGCCTTACTGGCTCGCGACGACGACGCGACGAGGGAACGC
CTCGACGCCCGTCTCTCCCTGTGGAGTGAGCAAAAGAATACCTCGGTCCGGCTCCTGGGCGTCAGGAGCGAGACG
GACGGGGTGCGGTCGGAAGACCTGGACGTCTACGCCGGCTGGCTATAA
Gene >Ophio5|3984
ATGCGACTCTGCGCAAAGCTTCTCCTTCTCTTTCCTCTCCTCTCCTCTCCTCTCCTACATGACCCATCTCGTCAG
TCCCTCAAAGGCATTTGTTCGGTGACTTTTGAACCGTCATCTACCGTCTTCTCACCCCAAAACAAGGCCGGCCCA
ATGCCGACTCCACAACGTCCGACAGTTGCCGTCTCGGCGCCGGGCAAGGTGCTGCTCACGGGCGGCTACCTGGTG
CTCGACCGGGAGCACACCGGGCTGGTGTCGGGGCTCAGCGCACGAATCAACGTGGTGGCGGGCGAGATCACGACA
GGCCAGGGCGTACAGCTGAGCGAGATGGTCGTCGACAGCCCGCAGTTCCTCGACGCGCAGTGGCGCTATGGGTAC
CATCTCGCGGCCGAGGGAGGCGGCATCAAGGTGACGCAGCTACAGGTGTGAGTCCCGGGCATGGCAAGGGGAAGC
GGTCGAATGCCGTGTCTAACTCGGACAGCGGATCTAGAATCTCGCGTAACAAGTTTGTCGAGACGACGTTGAGTT
TTGTTCTGACCTATATCAATCACGTCGCCCTGTCGTCTTCGGGGAGAGGCATCGGCTCGGCTCGGCTCATCATAC
TGGCCGACAATGACTATTATTCGCAGACGCCTTCTGCCGCATTCGATGCTCGTGGTCGCTTCGCCAAGTTCACCG
TTCCGCTGACGAGGGCACATAAGACGGGGCTCGGCTCTTCGGCTGCTCTCGTCACCGCCATCGCCGCCTCTCTGC
TGTGTCATTACCTGCCGGAGGACAGATTCGACGTGTCGACGACGAAGGGTCGGGCCACGTTGCATAATCTGGCTC
AGGCCGCTCACTGCGCTGCCCAGGGGAAAGTGGGCTCTGGCTTCGACGTCGCCGCCGCCGTCTACGGCTCCTGTG
TCTACCGCCGCTTCTCCCCGCATGTGCTGAGCCGGCTGCCGGCGCCCGGTGAGGCCGGCTTTAGCGATAGCTTGG
CGGCTGTCGTCGACGGCGGCTGGGATGTGGAGATTGACTCTGGCGGGATGCGTATACCCGACGGCCTGACGCTGC
ACATGTGCGACGTCGACGGCGGCACCCAGTCGGTCGGTATGGCGAAGAAGGTCTTGTCCTGGAGAAGCCGCCATC
CCGAGACCTGCAGCGAGCTCTGGCAGCGGCTCCAGACGGCCAACGACGCGCTTGCGGATCATCTCCGCAGCGGGA
CTGTCGATCAGCTTCCCGATGCCATCCGCGCCATTCGCGTTCTGCTTCGTGATATGGGCAAGCTCAGCGACGTGC
CCATCGAGCCCGAGTCTCAGACGGAGCTGCTCGACGCCGTCAGCGCCGTCGACGGCGTCTACGGAGGCGTCGTCC
CCGGTGCTGGCGGTTTCGACGCCCTAGCCTTACTGGCTCGCGACGACGACGCGACGAGGGAACGCCTCGACGCCC
GTCTCTCCCTGTGGAGTGAGCAAAAGAATACCTCGGTCCGGCTCCTGGGCGTCAGGAGCGAGACGGACGGGGTGC
GGTCGGAAGACCTGGACGTCTACGCCGGCTGGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail