Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3980
Gene name
Locationscaffold_31:48190..48812
Strand+
Gene length (bp)622
Transcript length (bp)396
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08507 COPI_assoc COPI associated protein 8.8E-33 6 121

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14223|TVP15_SCHPO Golgi apparatus membrane protein tvp15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tvp15 PE=3 SV=2 1 122 1.0E-19
sp|Q03860|TVP15_YEAST Golgi apparatus membrane protein TVP15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP15 PE=1 SV=1 7 119 8.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 52 19
3 65 87 22
4 91 109 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 332.66 182.67 482.66
CcL In ants, during behavior modification 204.11 104.90 303.33
CcD In ants, recently dead 158.85 78.31 239.39

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.030588 yes
SC16a CcD 0.001647 yes
CcL CcD 0.338183 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3980
MELSDTFRLVNLGVGAITVLGGIAQIFGFKLQTIVVGAYMIVFGLAIALLEFQIPPQISRYASFLFSFIGRGAFY
IFIGCLLLGGMILQNIAGAVVGIVGLAYVVLEFIPSIEPPANMREADGGGWTAEQV
Coding >Ophio5|3980
ATGGAGCTCTCCGATACCTTTCGCCTCGTGAACCTCGGAGTGGGCGCCATCACCGTCCTCGGAGGCATCGCGCAA
ATCTTCGGCTTCAAGCTTCAAACTATCGTCGTCGGTGCTTACATGATTGTCTTCGGCCTCGCCATCGCCCTCTTG
GAATTCCAGATTCCTCCTCAAATCTCACGATATGCCTCTTTCCTCTTCTCCTTCATCGGACGCGGTGCATTCTAC
ATCTTCATCGGATGTCTGCTCCTCGGTGGCATGATCCTCCAGAACATCGCCGGTGCTGTCGTTGGCATCGTTGGT
CTCGCATATGTCGTCCTCGAGTTTATCCCTTCTATCGAACCTCCAGCCAATATGCGCGAAGCCGACGGCGGTGGC
TGGACTGCCGAGCAGGTG
Transcript >Ophio5|3980
ATGGAGCTCTCCGATACCTTTCGCCTCGTGAACCTCGGAGTGGGCGCCATCACCGTCCTCGGAGGCATCGCGCAA
ATCTTCGGCTTCAAGCTTCAAACTATCGTCGTCGGTGCTTACATGATTGTCTTCGGCCTCGCCATCGCCCTCTTG
GAATTCCAGATTCCTCCTCAAATCTCACGATATGCCTCTTTCCTCTTCTCCTTCATCGGACGCGGTGCATTCTAC
ATCTTCATCGGATGTCTGCTCCTCGGTGGCATGATCCTCCAGAACATCGCCGGTGCTGTCGTTGGCATCGTTGGT
CTCGCATATGTCGTCCTCGAGTTTATCCCTTCTATCGAACCTCCAGCCAATATGCGCGAAGCCGACGGCGGTGGC
TGGACTGCCGAGCAGGTGTAA
Gene >Ophio5|3980
ATGGAGCTCTCCGATACCTTGTTCGTGTCGAAGCTGGACTACTGCTGCCTTGGACGCTAACGCGCGTCAGTCGCC
TCGTGAACCTCGGAGTGGGCGCCATCACCGTCCTCGGAGGCATCGCGCAAATCTTCGGCTTCAAGCTGTGCGTCC
CTTATTCTATTCCCTGGCGCATCGTCGTCAGCGCTGACTTGTCCCTGCCATCTAGTCAAACTATCGTCGTCGGTG
CTTACATGATTGTCTTCGGCCTCGCCATCGCCCTCTTGGGTTCGTCGACTTTCCATCGTCGTTCTTGTTCGCGAC
TCGGTTGACACTCGATATAGAATTCCAGATTCCTCCTCAAATCTCACGATATGCCTCTTTCCTCTTCTCCTTCAT
CGGACGCGGTGCATGTGCGTTTCCCCCCTCCTTACCTATACTTCCTTGGCTGATTCCTTGCCGCCACCAAGTCTA
CATCTTCATCGGATGTCTGCTCCTCGGTGGCATGATCCTCCAGAACATCGCCGGTGCTGTCGTTGGCATCGTTGG
TCTCGCATATGTCGTCCTCGAGTTTATCCCTTCTATCGAACCTCCAGCCAATATGCGCGAAGCCGACGGCGGTGG
CTGGACTGCCGAGCAGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail