Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|397
Gene name
Locationscaffold_1098:457..947
Strand+
Gene length (bp)490
Transcript length (bp)336
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13233 Complex1_LYR_2 Complex1_LYR-like 1.2E-18 16 94
PF05347 Complex1_LYR Complex 1 protein (LYR family) 5.3E-11 16 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IN52|SDHF3_GIBZE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_01356 PE=3 SV=1 3 107 3.0E-53
sp|Q7SF55|SDHF3_NEUCR Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-17 PE=3 SV=1 4 107 1.0E-51
sp|P0C146|SDHF3_MAGO7 Succinate dehydrogenase assembly factor 3, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_17437 PE=3 SV=2 19 109 1.0E-46
sp|Q5BBH7|SDHF3_EMENI Succinate dehydrogenase assembly factor 3, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2103 PE=3 SV=1 11 107 1.0E-44
sp|Q4WHK3|SDHF3_ASPFU Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G05090 PE=3 SV=1 19 106 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IN52|SDHF3_GIBZE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_01356 PE=3 SV=1 3 107 3.0E-53
sp|Q7SF55|SDHF3_NEUCR Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-17 PE=3 SV=1 4 107 1.0E-51
sp|P0C146|SDHF3_MAGO7 Succinate dehydrogenase assembly factor 3, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_17437 PE=3 SV=2 19 109 1.0E-46
sp|Q5BBH7|SDHF3_EMENI Succinate dehydrogenase assembly factor 3, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2103 PE=3 SV=1 11 107 1.0E-44
sp|Q4WHK3|SDHF3_ASPFU Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G05090 PE=3 SV=1 19 106 1.0E-40
sp|Q59L89|SDHF3_CANAL Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SDH7 PE=3 SV=1 9 107 2.0E-33
sp|Q9P7Y2|SDHF3_SCHPO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.03c PE=3 SV=1 12 111 2.0E-33
sp|Q751X1|SDHF3_ASHGO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR704W PE=3 SV=1 1 107 9.0E-32
sp|Q6BIY6|SDHF3_DEBHA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G06622g PE=3 SV=1 9 107 2.0E-31
sp|Q6FMR7|SDHF3_CANGA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K05775g PE=3 SV=1 11 107 2.0E-29
sp|Q04401|SDHF3_YEAST Succinate dehydrogenase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH7 PE=1 SV=1 12 107 1.0E-28
sp|Q4PCI7|SDHF3_USTMA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10065 PE=3 SV=2 8 107 1.0E-28
sp|Q6CUY0|SDHF3_KLULA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C01430g PE=3 SV=1 12 111 3.0E-25
sp|P0CM00|SDHF3_CRYNJ Succinate dehydrogenase assembly factor 3, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB04080 PE=3 SV=1 4 106 2.0E-20
sp|P0CM01|SDHF3_CRYNB Succinate dehydrogenase assembly factor 3, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB1660 PE=3 SV=1 4 106 2.0E-20
sp|Q6TUF2|SDHF3_RAT Succinate dehydrogenase assembly factor 3, mitochondrial OS=Rattus norvegicus GN=Sdhaf3 PE=2 SV=2 17 110 1.0E-13
sp|Q8BQU3|SDHF3_MOUSE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Mus musculus GN=Sdhaf3 PE=2 SV=1 17 110 1.0E-13
sp|Q8SZ16|SDHF3_DROME Succinate dehydrogenase assembly factor 3, mitochondrial OS=Drosophila melanogaster GN=Sdhaf3 PE=2 SV=1 18 104 5.0E-13
sp|A7S1H9|SDHF3_NEMVE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Nematostella vectensis GN=acn9 PE=3 SV=1 17 104 6.0E-13
sp|Q9NRP4|SDHF3_HUMAN Succinate dehydrogenase assembly factor 3, mitochondrial OS=Homo sapiens GN=SDHAF3 PE=1 SV=1 17 110 1.0E-11
sp|Q0P574|SDHF3_BOVIN Succinate dehydrogenase assembly factor 3, mitochondrial OS=Bos taurus GN=SDHAF3 PE=2 SV=1 17 110 7.0E-09
sp|Q5XIY4|SDHF3_DANRE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Danio rerio GN=sdhaf3 PE=2 SV=1 17 102 8.0E-09
sp|Q86H49|SDHF3_DICDI Succinate dehydrogenase assembly factor 3, mitochondrial OS=Dictyostelium discoideum GN=acn9 PE=3 SV=1 16 69 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|397
MLRSLGPACAALLPPIALYRRLLRAHRKHLPAPMRVLGDEYVKAEFRSHRNVDNPAHLIGFLAEWQLYAQQIEGD
SWAGDKIDPAKLDKLSEEQMRQLFELMQAIQKHKRA
Coding >Ophio5|397
ATGCTGCGAAGCCTCGGACCCGCCTGCGCGGCTCTACTCCCGCCAATAGCCTTGTACCGACGACTACTGCGTGCG
CACCGGAAGCATCTACCCGCCCCTATGCGCGTCCTGGGCGACGAGTACGTCAAGGCAGAGTTCCGCTCTCATCGA
AACGTCGATAACCCGGCTCATCTGATTGGCTTCCTCGCGGAGTGGCAGCTCTATGCCCAGCAGATTGAGGGAGAC
TCTTGGGCCGGTGACAAGATTGACCCCGCAAAGTTGGATAAGCTGAGCGAGGAGCAGATGCGACAGCTCTTCGAG
TTGATGCAGGCAATCCAGAAGCACAAACGGGCG
Transcript >Ophio5|397
ATGCTGCGAAGCCTCGGACCCGCCTGCGCGGCTCTACTCCCGCCAATAGCCTTGTACCGACGACTACTGCGTGCG
CACCGGAAGCATCTACCCGCCCCTATGCGCGTCCTGGGCGACGAGTACGTCAAGGCAGAGTTCCGCTCTCATCGA
AACGTCGATAACCCGGCTCATCTGATTGGCTTCCTCGCGGAGTGGCAGCTCTATGCCCAGCAGATTGAGGGAGAC
TCTTGGGCCGGTGACAAGATTGACCCCGCAAAGTTGGATAAGCTGAGCGAGGAGCAGATGCGACAGCTCTTCGAG
TTGATGCAGGCAATCCAGAAGCACAAACGGGCGTAG
Gene >Ophio5|397
ATGCTGCGAAGCCTCGGACCCGCCTGCGCGGCTCTACTCCCGCCAATAGCCTTGTACCGACGACTACTGCGTGCG
CACCGGAAGCATCTACCCGCCCCTATGCGCGTCCTGGGCGACGAGTACGTCAAGGCAGAGTTCCGCTCTCATCGA
AACGTCGATAACCCGGCTCATCTGGTGAGTCGCTGGCCGTGAAGTCGAGCACGTCCTACTACTCTACAGCCTTTT
GACGTGGCGCGCGCTCGTCTTCAAGATTGGCTTCCTCGCGGAGTGGCAGCTCTATGCCCAGCAGATTGAGGGAGA
CTCTTGGGCCGGTGACAAGATTGACCCCGCAAAGTTGGATAAGCTGAGCGGTAAGCTGCAACGCCTAATCGATTT
TCACATGCGGGTATCTGTGGAGCATGAGGCTCACGGGTGCGCGTCGCCACTAGAGGAGCAGATGCGACAGCTCTT
CGAGTTGATGCAGGCAATCCAGAAGCACAAACGGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail