Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3969
Gene name
Locationscaffold_31:14266..17754
Strand+
Gene length (bp)3488
Transcript length (bp)3429
Coding sequence length (bp)3426
Protein length (aa) 1142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 7.7E-09 104 339
PF13515 FUSC_2 Fusaric acid resistance protein-like 6.3E-12 678 801

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 13 1119 4.0E-83
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 633 1032 3.0E-19
sp|P87136|YDM5_SCHPO Uncharacterized protein C57A7.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.05 PE=4 SV=1 656 1032 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 74 96 22
3 106 124 18
4 131 153 22
5 157 179 22
6 658 680 22
7 703 725 22
8 732 749 17
9 759 781 22
10 788 810 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 36.56 19.87 53.25
CcL In ants, during behavior modification 45.17 23.29 67.06
CcD In ants, recently dead 47.25 25.30 69.19

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.390949 no
SC16a CcD 0.288211 no
CcL CcD 0.880276 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3969
MESSHLLQSLVAFLWGLRQENALWQAILKFFIASIAALGLALLPALRTDSTFLIVMVVIFAHPGQRMGCMIQSLL
MVLFGAILGLSWSLLGLRLAFLVESRNSAAASTIRALFFLVLILIHGYLRSLKPRLLLFVLFLIIPAVLTIQLPA
SVTSSIFITIYFPILMGAGLSLVVNLALFPELSSTYLGSTTISALSETVDTLTRATNWFVTPGCDPESAPVETAS
SRHESLKPGQAAKLSALAKFFAQFPNPFQAVKHGSALSALPHHSTNLVHLTAQKPKLRACVARCRAVQDEVNFEI
SLSPLPPTALKPISIQYMTGLVRNVTTLIGACENKFVVVGTNESSGRSLSGENGEASGRMAKKAGKRSGKKGTRR
ASRPGKADSAKPFPTVKPIKEIETSSAELLEAILTRIRRPAQDFQVSVAEAANLVILCLAYCFDVPKLPSGAAAP
RSMSLQELDVRIDKFARSLTLFDTEAADQLKQAMMDKSYEPIDFMPGMETFMASSFILSLRDSAAQLLEMLRHLR
LLVESRQRRHDRSRLWVPQFTKFRQWFANRRSSKATELVEVSSIGQRPVGHHAAGPIPGVGEFRSRRISDEESRI
GQTVQWAELKSPKKKRSSKKRARRKLELENLGLMAKTREKAADALEWAQNSNDLDYALKLAVAMFLLLWPAFVTS
WRPWYNQVRGIWAPMQLMLVFEVCIGSSAFGFVLRLIGVTFGCVAGFAAYEIGRGNRIAVAVLLLVSILPSIYIQ
LATKYVKVAMVSMVSMVVVAVASVNGTIPAYEIFYKRLVAFLVGGFVAMLVEVVIAPVRARDRLVECLSYSVRQV
QKMEMSLSVGIEGPWSPNIRSQALIARFNRARDKAQGALAEAETALPFCLSEPRLKGSFKPLAPIYTEIIYVLHQ
IIDRMDNVIQLRRTYGSSILEELNPKLYAYRRNVAASTTLILFSINEALTTWLPLPQFIPSARLALLRLISRVRE
IVASENTAKGDRAELNEETASLITKRKFLSWNAGTVGQMEIIEYLEELVELVKLLVGVNAFRSGMLKRSTYRQRL
GQGVGTDVDAAPSGTPAAASSPETDGDAKTWAPIRRTDMMESAVDDMDECETSSDSGSWDEGIPLSLQRVGTRLR
RDSSVVRRRPVSTTGTP
Coding >Ophio5|3969
ATGGAGTCTTCACATCTCCTACAGAGCCTCGTCGCCTTCCTATGGGGCCTTCGTCAGGAAAATGCCTTGTGGCAG
GCCATACTCAAGTTCTTCATCGCCAGTATCGCCGCTCTCGGCCTTGCCCTCCTCCCTGCTTTGCGCACCGACTCT
ACCTTCTTGATAGTCATGGTCGTCATCTTTGCCCACCCCGGCCAGAGAATGGGCTGTATGATTCAATCGCTCCTC
ATGGTCCTTTTTGGCGCAATCCTCGGCCTGTCATGGTCGCTGCTGGGTCTTCGTCTGGCATTTCTCGTCGAAAGC
CGCAACTCGGCTGCCGCTAGCACCATTCGAGCCCTCTTTTTCCTTGTGCTCATCCTTATACACGGCTACTTGCGG
TCATTAAAACCTCGACTCTTGCTTTTCGTTCTGTTCCTAATCATCCCGGCCGTCTTGACCATTCAGCTGCCAGCC
AGTGTTACGAGCTCCATCTTCATCACGATATACTTTCCCATACTGATGGGCGCCGGTCTGTCGCTTGTTGTCAAC
CTTGCACTTTTCCCGGAGCTCTCTAGCACGTACCTGGGCTCTACAACTATCAGCGCGCTGTCAGAGACGGTCGAC
ACTTTGACGCGCGCAACCAATTGGTTCGTCACCCCCGGCTGCGATCCGGAATCCGCCCCTGTCGAGACCGCATCC
TCTAGACACGAGTCTCTAAAGCCTGGCCAAGCCGCAAAATTGAGTGCGCTGGCCAAATTCTTTGCCCAGTTTCCC
AATCCCTTCCAGGCTGTCAAGCATGGGTCTGCCTTGTCTGCTCTTCCCCATCACTCCACCAACTTGGTTCACCTG
ACGGCACAAAAGCCCAAGCTGCGTGCCTGTGTCGCTCGTTGTAGAGCGGTTCAAGATGAAGTCAACTTCGAGATA
TCTCTGTCGCCTCTGCCACCGACTGCATTGAAACCAATCAGTATTCAGTACATGACAGGTCTGGTTCGAAACGTC
ACCACCCTGATTGGTGCTTGCGAAAACAAGTTTGTTGTTGTCGGCACAAACGAAAGCTCAGGCCGATCCTTGTCG
GGCGAAAATGGCGAAGCATCGGGCAGAATGGCCAAGAAAGCAGGAAAGAGGTCAGGGAAGAAGGGCACGAGAAGA
GCGTCTCGTCCTGGCAAGGCAGACAGCGCGAAGCCCTTTCCCACCGTGAAGCCCATCAAGGAAATCGAAACAAGC
AGTGCCGAGCTACTGGAAGCAATCCTCACCCGCATTCGACGCCCCGCACAAGACTTTCAAGTGTCTGTGGCGGAG
GCGGCCAATCTCGTCATCCTGTGTCTCGCCTACTGCTTCGACGTGCCGAAGCTTCCCTCGGGTGCCGCAGCTCCC
AGGAGCATGTCTCTGCAGGAACTTGATGTGAGAATTGACAAGTTTGCCCGCTCTCTGACTCTTTTCGACACGGAA
GCCGCCGATCAGCTCAAACAGGCCATGATGGACAAGTCGTATGAGCCAATCGACTTTATGCCCGGCATGGAGACA
TTCATGGCATCGTCCTTTATTCTCTCTCTTCGAGACTCTGCGGCACAGTTGTTGGAGATGCTCCGTCACTTGCGG
CTCCTCGTCGAGAGCAGGCAGCGCCGCCACGACCGTTCCCGACTCTGGGTGCCGCAGTTCACCAAGTTTCGCCAG
TGGTTCGCGAATCGGAGGTCAAGCAAGGCCACAGAACTCGTCGAGGTGTCTAGTATCGGTCAGCGCCCGGTTGGG
CACCATGCCGCTGGGCCAATCCCAGGAGTTGGCGAATTTCGCTCTCGTCGGATTTCAGACGAAGAAAGTCGCATC
GGTCAAACCGTGCAGTGGGCGGAGCTGAAGTCGCCAAAGAAGAAAAGGTCATCGAAAAAGCGAGCACGACGCAAA
CTGGAGCTCGAAAACCTCGGCTTGATGGCAAAGACGAGGGAAAAGGCAGCCGACGCTCTGGAATGGGCCCAGAAC
TCGAATGACCTGGATTACGCCCTCAAGCTGGCTGTCGCCATGTTTCTCCTTCTCTGGCCGGCCTTTGTGACGTCG
TGGAGGCCATGGTACAACCAGGTTCGCGGCATCTGGGCGCCCATGCAATTGATGTTGGTCTTCGAGGTGTGCATT
GGCAGTTCGGCCTTTGGTTTCGTCCTTCGCCTCATTGGCGTCACCTTTGGCTGCGTGGCTGGGTTTGCTGCGTAC
GAGATTGGCAGAGGCAACCGAATTGCCGTTGCCGTCCTCCTTCTCGTTTCAATCTTGCCCTCCATCTACATCCAA
CTCGCTACCAAGTACGTCAAAGTAGCCATGGTCTCGATGGTGTCCATGGTTGTCGTCGCTGTCGCTTCGGTCAAT
GGTACTATCCCTGCATACGAGATATTTTACAAGCGTCTTGTGGCCTTTTTGGTCGGCGGCTTCGTTGCTATGCTG
GTCGAGGTCGTCATTGCCCCGGTCCGGGCCCGAGATCGCTTGGTCGAATGTCTGTCTTACTCCGTCCGCCAAGTT
CAGAAAATGGAAATGTCTCTTTCTGTTGGCATCGAGGGGCCCTGGAGTCCCAACATCCGCTCGCAAGCTCTCATT
GCCCGCTTCAATCGCGCCCGCGACAAGGCGCAGGGGGCGCTCGCCGAGGCCGAGACTGCCCTGCCTTTCTGCCTC
AGTGAGCCACGTCTGAAGGGAAGCTTCAAGCCGCTTGCTCCTATATACACGGAGATCATTTACGTGCTTCATCAG
ATTATAGATCGGATGGACAACGTGATTCAGCTCCGACGAACCTACGGATCGTCTATCCTGGAAGAGCTAAATCCC
AAGTTGTACGCGTATCGGAGAAACGTGGCGGCCAGCACAACGTTGATCTTGTTCTCCATCAACGAAGCCCTGACT
ACGTGGCTGCCTCTCCCGCAGTTCATCCCATCGGCCCGGCTCGCCCTGCTACGCTTGATCAGTCGCGTGCGCGAA
ATCGTCGCGTCGGAGAACACGGCAAAGGGTGATCGGGCCGAGCTGAACGAGGAGACGGCAAGTCTCATCACCAAA
CGCAAATTCTTGTCGTGGAACGCCGGCACGGTCGGTCAGATGGAGATCATCGAGTATCTCGAGGAGCTCGTCGAG
CTGGTCAAGCTCTTGGTGGGCGTCAACGCCTTCAGGAGCGGCATGCTGAAGCGTTCGACGTACAGGCAGCGCCTC
GGCCAGGGTGTCGGCACCGACGTCGACGCCGCTCCCTCCGGGACCCCGGCAGCAGCTAGCTCGCCGGAGACGGAT
GGAGACGCCAAGACCTGGGCTCCGATACGGCGGACGGACATGATGGAATCGGCGGTGGACGACATGGATGAGTGC
GAGACGAGCTCTGATAGCGGGAGTTGGGATGAGGGCATCCCGCTCAGCTTGCAAAGGGTCGGTACCCGCTTGAGA
AGGGATAGCTCGGTGGTGAGGAGGAGACCAGTTTCTACAACGGGGACCCCG
Transcript >Ophio5|3969
ATGGAGTCTTCACATCTCCTACAGAGCCTCGTCGCCTTCCTATGGGGCCTTCGTCAGGAAAATGCCTTGTGGCAG
GCCATACTCAAGTTCTTCATCGCCAGTATCGCCGCTCTCGGCCTTGCCCTCCTCCCTGCTTTGCGCACCGACTCT
ACCTTCTTGATAGTCATGGTCGTCATCTTTGCCCACCCCGGCCAGAGAATGGGCTGTATGATTCAATCGCTCCTC
ATGGTCCTTTTTGGCGCAATCCTCGGCCTGTCATGGTCGCTGCTGGGTCTTCGTCTGGCATTTCTCGTCGAAAGC
CGCAACTCGGCTGCCGCTAGCACCATTCGAGCCCTCTTTTTCCTTGTGCTCATCCTTATACACGGCTACTTGCGG
TCATTAAAACCTCGACTCTTGCTTTTCGTTCTGTTCCTAATCATCCCGGCCGTCTTGACCATTCAGCTGCCAGCC
AGTGTTACGAGCTCCATCTTCATCACGATATACTTTCCCATACTGATGGGCGCCGGTCTGTCGCTTGTTGTCAAC
CTTGCACTTTTCCCGGAGCTCTCTAGCACGTACCTGGGCTCTACAACTATCAGCGCGCTGTCAGAGACGGTCGAC
ACTTTGACGCGCGCAACCAATTGGTTCGTCACCCCCGGCTGCGATCCGGAATCCGCCCCTGTCGAGACCGCATCC
TCTAGACACGAGTCTCTAAAGCCTGGCCAAGCCGCAAAATTGAGTGCGCTGGCCAAATTCTTTGCCCAGTTTCCC
AATCCCTTCCAGGCTGTCAAGCATGGGTCTGCCTTGTCTGCTCTTCCCCATCACTCCACCAACTTGGTTCACCTG
ACGGCACAAAAGCCCAAGCTGCGTGCCTGTGTCGCTCGTTGTAGAGCGGTTCAAGATGAAGTCAACTTCGAGATA
TCTCTGTCGCCTCTGCCACCGACTGCATTGAAACCAATCAGTATTCAGTACATGACAGGTCTGGTTCGAAACGTC
ACCACCCTGATTGGTGCTTGCGAAAACAAGTTTGTTGTTGTCGGCACAAACGAAAGCTCAGGCCGATCCTTGTCG
GGCGAAAATGGCGAAGCATCGGGCAGAATGGCCAAGAAAGCAGGAAAGAGGTCAGGGAAGAAGGGCACGAGAAGA
GCGTCTCGTCCTGGCAAGGCAGACAGCGCGAAGCCCTTTCCCACCGTGAAGCCCATCAAGGAAATCGAAACAAGC
AGTGCCGAGCTACTGGAAGCAATCCTCACCCGCATTCGACGCCCCGCACAAGACTTTCAAGTGTCTGTGGCGGAG
GCGGCCAATCTCGTCATCCTGTGTCTCGCCTACTGCTTCGACGTGCCGAAGCTTCCCTCGGGTGCCGCAGCTCCC
AGGAGCATGTCTCTGCAGGAACTTGATGTGAGAATTGACAAGTTTGCCCGCTCTCTGACTCTTTTCGACACGGAA
GCCGCCGATCAGCTCAAACAGGCCATGATGGACAAGTCGTATGAGCCAATCGACTTTATGCCCGGCATGGAGACA
TTCATGGCATCGTCCTTTATTCTCTCTCTTCGAGACTCTGCGGCACAGTTGTTGGAGATGCTCCGTCACTTGCGG
CTCCTCGTCGAGAGCAGGCAGCGCCGCCACGACCGTTCCCGACTCTGGGTGCCGCAGTTCACCAAGTTTCGCCAG
TGGTTCGCGAATCGGAGGTCAAGCAAGGCCACAGAACTCGTCGAGGTGTCTAGTATCGGTCAGCGCCCGGTTGGG
CACCATGCCGCTGGGCCAATCCCAGGAGTTGGCGAATTTCGCTCTCGTCGGATTTCAGACGAAGAAAGTCGCATC
GGTCAAACCGTGCAGTGGGCGGAGCTGAAGTCGCCAAAGAAGAAAAGGTCATCGAAAAAGCGAGCACGACGCAAA
CTGGAGCTCGAAAACCTCGGCTTGATGGCAAAGACGAGGGAAAAGGCAGCCGACGCTCTGGAATGGGCCCAGAAC
TCGAATGACCTGGATTACGCCCTCAAGCTGGCTGTCGCCATGTTTCTCCTTCTCTGGCCGGCCTTTGTGACGTCG
TGGAGGCCATGGTACAACCAGGTTCGCGGCATCTGGGCGCCCATGCAATTGATGTTGGTCTTCGAGGTGTGCATT
GGCAGTTCGGCCTTTGGTTTCGTCCTTCGCCTCATTGGCGTCACCTTTGGCTGCGTGGCTGGGTTTGCTGCGTAC
GAGATTGGCAGAGGCAACCGAATTGCCGTTGCCGTCCTCCTTCTCGTTTCAATCTTGCCCTCCATCTACATCCAA
CTCGCTACCAAGTACGTCAAAGTAGCCATGGTCTCGATGGTGTCCATGGTTGTCGTCGCTGTCGCTTCGGTCAAT
GGTACTATCCCTGCATACGAGATATTTTACAAGCGTCTTGTGGCCTTTTTGGTCGGCGGCTTCGTTGCTATGCTG
GTCGAGGTCGTCATTGCCCCGGTCCGGGCCCGAGATCGCTTGGTCGAATGTCTGTCTTACTCCGTCCGCCAAGTT
CAGAAAATGGAAATGTCTCTTTCTGTTGGCATCGAGGGGCCCTGGAGTCCCAACATCCGCTCGCAAGCTCTCATT
GCCCGCTTCAATCGCGCCCGCGACAAGGCGCAGGGGGCGCTCGCCGAGGCCGAGACTGCCCTGCCTTTCTGCCTC
AGTGAGCCACGTCTGAAGGGAAGCTTCAAGCCGCTTGCTCCTATATACACGGAGATCATTTACGTGCTTCATCAG
ATTATAGATCGGATGGACAACGTGATTCAGCTCCGACGAACCTACGGATCGTCTATCCTGGAAGAGCTAAATCCC
AAGTTGTACGCGTATCGGAGAAACGTGGCGGCCAGCACAACGTTGATCTTGTTCTCCATCAACGAAGCCCTGACT
ACGTGGCTGCCTCTCCCGCAGTTCATCCCATCGGCCCGGCTCGCCCTGCTACGCTTGATCAGTCGCGTGCGCGAA
ATCGTCGCGTCGGAGAACACGGCAAAGGGTGATCGGGCCGAGCTGAACGAGGAGACGGCAAGTCTCATCACCAAA
CGCAAATTCTTGTCGTGGAACGCCGGCACGGTCGGTCAGATGGAGATCATCGAGTATCTCGAGGAGCTCGTCGAG
CTGGTCAAGCTCTTGGTGGGCGTCAACGCCTTCAGGAGCGGCATGCTGAAGCGTTCGACGTACAGGCAGCGCCTC
GGCCAGGGTGTCGGCACCGACGTCGACGCCGCTCCCTCCGGGACCCCGGCAGCAGCTAGCTCGCCGGAGACGGAT
GGAGACGCCAAGACCTGGGCTCCGATACGGCGGACGGACATGATGGAATCGGCGGTGGACGACATGGATGAGTGC
GAGACGAGCTCTGATAGCGGGAGTTGGGATGAGGGCATCCCGCTCAGCTTGCAAAGGGTCGGTACCCGCTTGAGA
AGGGATAGCTCGGTGGTGAGGAGGAGACCAGTTTCTACAACGGGGACCCCGTGA
Gene >Ophio5|3969
ATGGAGTCTTCACATCTCCTACAGAGCCTCGTCGCCTTCCTATGGGGCCTTCGTCAGGAAAATGCCTTGTGGCAG
GCCATACTCAAGTTCTTCATCGCCAGTATCGCCGCTCTCGGCCTTGCCCTCCTCCCTGCTTTGCGCACCGACTCT
ACCTTCTTGATAGTCATGGTCGTCATCTTTGCCCACCCCGGCCAGAGAATGGGCTGTATGATTCAATCGCTCCTC
ATGGTCCTTTTTGGCGCAATCCTCGGCCTGTCATGGTCGCTGCTGGGTCTTCGTCTGGCATTTCTCGTCGAAAGC
CGCAACTCGGCTGCCGCTAGCACCATTCGAGCCCTCTTTTTCCTTGTGCTCATCCTTATACACGGCTACTTGCGG
TCATTAAAACCTCGACTCTTGCTTTTCGTTCTGTTCCTAATCATCCCGGCCGTCTTGACCATTCAGCTGCCAGCC
AGTGTTACGAGCTCCATCTTCATCACGATATACTTTCCCATACTGATGGGCGCCGGTCTGTCGCTTGTTGTCAAC
CTTGCACTTTTCCCGGAGCTCTCTAGCACGTACCTGGGCTCTACAACTATCAGCGCGCTGTCAGAGACGGTCGAC
ACTTTGACGCGCGCAACCAATTGGTTCGTCACCCCCGGCTGCGATCCGGAATCCGCCCCTGTCGAGACCGCATCC
TCTAGACACGAGTCTCTAAAGCCTGGCCAAGCCGCAAAATTGAGTGCGCTGGCCAAATTCTTTGCCCAGTTTCCC
AATCCCTTCCAGGCTGTCAAGCATGGGTCTGCCTTGTCTGCTCTTCCCCATCACTCCACCAACTTGGTTCACCTG
ACGGCACAAAAGCCCAAGCTGCGTGCCTGTGTCGCTCGTTGTAGAGCGGTTCAAGATGAAGTCAACTTCGAGATA
TCTCTGTCGCCTCTGCCACCGACTGCATTGAAACCAATCAGTATTCAGTACATGACAGGTCTGGTTCGAAACGTC
ACCACCCTGATTGGTGCTTGCGAAAACAAGTTTGTTGTTGTCGGCACAAACGAAAGCTCAGGCCGATCCTTGTCG
GGCGAAAATGGCGAAGCATCGGGCAGAATGGCCAAGAAAGCAGGAAAGAGGTCAGGGAAGAAGGGCACGAGAAGA
GCGTCTCGTCCTGGCAAGGCAGACAGCGCGAAGCCCTTTCCCACCGTGAAGCCCATCAAGGAAATCGAAACAAGC
AGTGCCGAGCTACTGGAAGCAATCCTCACCCGCATTCGACGCCCCGCACAAGACTTTCAAGTGTCTGTGGCGGAG
GCGGCCAATCTCGTCATCCTGTGTCTCGCCTACTGCTTCGACGTGCCGAAGCTTCCCTCGGGTGCCGCAGCTCCC
AGGAGCATGTCTCTGCAGGAACTTGATGTGAGAATTGACAAGTTTGCCCGCTCTCTGACTCTTTTCGACACGGAA
GCCGCCGATCAGCTCAAACAGGCCATGATGGACAAGTCGTATGAGCCAATCGACTTTATGCCCGGCATGGAGACA
TTCATGGCATCGTCCTTTATTCTCTCTCTTCGAGACTCTGCGGCACAGTTGTTGGAGATGCTCCGTCACTTGCGG
CTCCTCGTCGAGAGCAGGCAGCGCCGCCACGACCGTTCCCGACTCTGGGTGCCGCAGTTCACCAAGTTTCGCCAG
TGGTTCGCGAATCGGAGGTCAAGCAAGGCCACAGAACTCGTCGAGGTGTCTAGTATCGGTCAGCGCCCGGTTGGG
CACCATGCCGCTGGGCCAATCCCAGGAGTTGGCGAATTTCGCTCTCGTCGGATTTCAGACGAAGAAAGTCGCATC
GGTCAAACCGTGCAGTGGGCGGAGCTGAAGTCGCCAAAGAAGAAAAGGTCATCGAAAAAGCGAGCACGACGCAAA
CTGGAGCTCGAAAACCTCGGCTTGATGGCAAAGACGAGGGAAAAGGCAGCCGACGCTCTGGAATGGGCCCAGAAC
TCGAATGACCTGGATTACGCCCTCAAGCTGGCTGTCGCCATGTTTCTCCTTCTCTGGCCGGCCTTTGTGACGTCG
TGGAGGCCATGGTACAACCAGGTTCGCGGCATCTGGGCGCCCATGCAATTGATGTTGGTCTTCGAGGTGTGCATT
GGCAGTTCGGCCTTTGGTTTCGTCCTTCGCCTCATTGGCGTCACCTTTGGCTGCGTGGCTGGGTTTGCTGCGTAC
GAGATTGGCAGAGGCAACCGAATTGCCGTTGCCGTCCTCCTTCTCGTTTCAATCTTGCCCTCCATCTACATCCAA
CTCGCTACCAAGTACGTCAAAGTAGCCATGGTCTCGATGGTGTCCATGGTTGTCGTCGCTGTCGGTAAGTCGGGC
AATCGTACGCGGCCGGGGAAAGAAGCTGACGATTGTATTTCTGGTTAGCTTCGGTCAATGGTACTATCCCTGCAT
ACGAGATATTTTACAAGCGTCTTGTGGCCTTTTTGGTCGGCGGCTTCGTTGCTATGCTGGTCGAGGTCGTCATTG
CCCCGGTCCGGGCCCGAGATCGCTTGGTCGAATGTCTGTCTTACTCCGTCCGCCAAGTTCAGAAAATGGAAATGT
CTCTTTCTGTTGGCATCGAGGGGCCCTGGAGTCCCAACATCCGCTCGCAAGCTCTCATTGCCCGCTTCAATCGCG
CCCGCGACAAGGCGCAGGGGGCGCTCGCCGAGGCCGAGACTGCCCTGCCTTTCTGCCTCAGTGAGCCACGTCTGA
AGGGAAGCTTCAAGCCGCTTGCTCCTATATACACGGAGATCATTTACGTGCTTCATCAGATTATAGATCGGATGG
ACAACGTGATTCAGCTCCGACGAACCTACGGATCGTCTATCCTGGAAGAGCTAAATCCCAAGTTGTACGCGTATC
GGAGAAACGTGGCGGCCAGCACAACGTTGATCTTGTTCTCCATCAACGAAGCCCTGACTACGTGGCTGCCTCTCC
CGCAGTTCATCCCATCGGCCCGGCTCGCCCTGCTACGCTTGATCAGTCGCGTGCGCGAAATCGTCGCGTCGGAGA
ACACGGCAAAGGGTGATCGGGCCGAGCTGAACGAGGAGACGGCAAGTCTCATCACCAAACGCAAATTCTTGTCGT
GGAACGCCGGCACGGTCGGTCAGATGGAGATCATCGAGTATCTCGAGGAGCTCGTCGAGCTGGTCAAGCTCTTGG
TGGGCGTCAACGCCTTCAGGAGCGGCATGCTGAAGCGTTCGACGTACAGGCAGCGCCTCGGCCAGGGTGTCGGCA
CCGACGTCGACGCCGCTCCCTCCGGGACCCCGGCAGCAGCTAGCTCGCCGGAGACGGATGGAGACGCCAAGACCT
GGGCTCCGATACGGCGGACGGACATGATGGAATCGGCGGTGGACGACATGGATGAGTGCGAGACGAGCTCTGATA
GCGGGAGTTGGGATGAGGGCATCCCGCTCAGCTTGCAAAGGGTCGGTACCCGCTTGAGAAGGGATAGCTCGGTGG
TGAGGAGGAGACCAGTTTCTACAACGGGGACCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail