Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3957
Gene name
Locationscaffold_309:17245..18750
Strand+
Gene length (bp)1505
Transcript length (bp)1449
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01151 ELO GNS1/SUR4 family 4.5E-75 53 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TC9|SRE1_DICDI Elongation of fatty acids protein sre1 OS=Dictyostelium discoideum GN=sre1 PE=2 SV=1 191 346 3.0E-12
sp|Q20303|ELO6_CAEEL Elongation of very long chain fatty acids protein 6 OS=Caenorhabditis elegans GN=elo-6 PE=1 SV=1 175 317 3.0E-11
sp|Q9EQC4|ELOV4_MOUSE Elongation of very long chain fatty acids protein 4 OS=Mus musculus GN=Elovl4 PE=1 SV=2 196 288 7.0E-10
sp|Q86JM5|Y2012_DICDI Putative elongation of fatty acids protein DDB_G0272012 OS=Dictyostelium discoideum GN=DDB_G0272012 PE=3 SV=1 193 298 7.0E-10
sp|Q9GZR5|ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens GN=ELOVL4 PE=1 SV=1 196 288 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TC9|SRE1_DICDI Elongation of fatty acids protein sre1 OS=Dictyostelium discoideum GN=sre1 PE=2 SV=1 191 346 3.0E-12
sp|Q20303|ELO6_CAEEL Elongation of very long chain fatty acids protein 6 OS=Caenorhabditis elegans GN=elo-6 PE=1 SV=1 175 317 3.0E-11
sp|Q9EQC4|ELOV4_MOUSE Elongation of very long chain fatty acids protein 4 OS=Mus musculus GN=Elovl4 PE=1 SV=2 196 288 7.0E-10
sp|Q86JM5|Y2012_DICDI Putative elongation of fatty acids protein DDB_G0272012 OS=Dictyostelium discoideum GN=DDB_G0272012 PE=3 SV=1 193 298 7.0E-10
sp|Q9GZR5|ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens GN=ELOVL4 PE=1 SV=1 196 288 9.0E-10
sp|A1L3X0|ELOV7_HUMAN Elongation of very long chain fatty acids protein 7 OS=Homo sapiens GN=ELOVL7 PE=1 SV=1 178 301 3.0E-09
sp|P49191|ELO3_CAEEL Putative fatty acid elongation protein 3 OS=Caenorhabditis elegans GN=elo-3 PE=1 SV=2 198 292 3.0E-09
sp|Q3S8M4|ELOV4_MACMU Elongation of very long chain fatty acids protein 4 OS=Macaca mulatta GN=ELOVL4 PE=3 SV=1 196 288 3.0E-09
sp|Q95K73|ELOV4_MACFA Elongation of very long chain fatty acids protein 4 OS=Macaca fascicularis GN=ELOVL4 PE=2 SV=1 196 288 3.0E-09
sp|Q7LKX0|ELOH2_SCHPO Putative elongation of fatty acids protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1639.01c PE=3 SV=3 185 289 3.0E-09
sp|Q9HB03|ELOV3_HUMAN Elongation of very long chain fatty acids protein 3 OS=Homo sapiens GN=ELOVL3 PE=1 SV=2 173 297 4.0E-09
sp|Q54CJ4|ELOA_DICDI Elongation of fatty acids protein A OS=Dictyostelium discoideum GN=eloA PE=2 SV=1 196 291 7.0E-09
sp|Q9BW60|ELOV1_HUMAN Elongation of very long chain fatty acids protein 1 OS=Homo sapiens GN=ELOVL1 PE=1 SV=1 133 310 1.0E-08
sp|A0JNC4|ELOV7_BOVIN Elongation of very long chain fatty acids protein 7 OS=Bos taurus GN=ELOVL7 PE=2 SV=1 196 299 1.0E-08
sp|Q9D2Y9|ELOV7_MOUSE Elongation of very long chain fatty acids protein 7 OS=Mus musculus GN=Elovl7 PE=2 SV=1 196 299 3.0E-08
sp|D4ADY9|ELOV7_RAT Elongation of very long chain fatty acids protein 7 OS=Rattus norvegicus GN=Elovl7 PE=3 SV=1 196 299 1.0E-07
sp|P39540|ELO1_YEAST Elongation of fatty acids protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO1 PE=1 SV=1 187 329 1.0E-07
sp|P40319|ELO3_YEAST Elongation of fatty acids protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO3 PE=1 SV=1 199 295 2.0E-07
sp|Q32NI8|ELOV5_XENLA Elongation of very long chain fatty acids protein 5 OS=Xenopus laevis GN=elovl5 PE=2 SV=1 196 290 3.0E-07
sp|Q20300|ELO5_CAEEL Elongation of very long chain fatty acids protein 5 OS=Caenorhabditis elegans GN=elo-5 PE=1 SV=1 196 299 3.0E-07
sp|Q6PC64|ELOV6_DANRE Elongation of very long chain fatty acids protein 6 OS=Danio rerio GN=elovl6 PE=2 SV=1 192 292 4.0E-07
sp|D4A612|ELOV2_RAT Elongation of very long chain fatty acids protein 2 OS=Rattus norvegicus GN=Elovl2 PE=1 SV=1 196 290 5.0E-07
sp|Q9JLJ5|ELOV1_MOUSE Elongation of very long chain fatty acids protein 1 OS=Mus musculus GN=Elovl1 PE=1 SV=1 133 306 5.0E-07
sp|Q9NXB9|ELOV2_HUMAN Elongation of very long chain fatty acids protein 2 OS=Homo sapiens GN=ELOVL2 PE=1 SV=2 196 290 7.0E-07
sp|Q5M8U1|ELOV5_XENTR Elongation of very long chain fatty acids protein 5 OS=Xenopus tropicalis GN=elovl5 PE=2 SV=1 196 290 9.0E-07
sp|Q9JLJ4|ELOV2_MOUSE Elongation of very long chain fatty acids protein 2 OS=Mus musculus GN=Elovl2 PE=1 SV=1 196 290 1.0E-06
sp|Q9UTF7|ELOH1_SCHPO Putative elongation of fatty acids protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B2.03c PE=1 SV=1 173 290 1.0E-06
sp|P25358|ELO2_YEAST Elongation of fatty acids protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO2 PE=1 SV=1 187 294 1.0E-06
sp|Q8BHI7|ELOV5_MOUSE Elongation of very long chain fatty acids protein 5 OS=Mus musculus GN=Elovl5 PE=1 SV=1 124 300 2.0E-06
sp|O35949|ELOV3_MOUSE Elongation of very long chain fatty acids protein 3 OS=Mus musculus GN=Elovl3 PE=1 SV=1 193 298 5.0E-06
sp|Q2KJD9|ELOV5_BOVIN Elongation of very long chain fatty acids protein 5 OS=Bos taurus GN=ELOVL5 PE=2 SV=1 196 290 6.0E-06
sp|Q920L6|ELOV6_RAT Elongation of very long chain fatty acids protein 6 OS=Rattus norvegicus GN=Elovl6 PE=1 SV=1 102 292 6.0E-06
sp|Q9H5J4|ELOV6_HUMAN Elongation of very long chain fatty acids protein 6 OS=Homo sapiens GN=ELOVL6 PE=1 SV=1 174 292 8.0E-06
sp|Q920L5|ELOV6_MOUSE Elongation of very long chain fatty acids protein 6 OS=Mus musculus GN=Elovl6 PE=1 SV=1 102 292 8.0E-06
sp|Q9NYP7|ELOV5_HUMAN Elongation of very long chain fatty acids protein 5 OS=Homo sapiens GN=ELOVL5 PE=1 SV=1 196 290 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0009922 fatty acid elongase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0004312 fatty acid synthase activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 92 114 22
3 244 266 22
4 287 309 22
5 379 401 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3957
MFFANTHHVAVTMPYSSQFILPPSGQAAPLAPAPRPLSFLRPFNIPENVYTAALDARVPLTIATMYAVSATLLSW
YNRSRNKRPWAISKTRLFFAFVVLHNVFLALYSAWTFWGMLGVMRRSFRQPWGPGGLPAMLDGFCRMHGPGRLGS
SLYYHEASGRWLSADASSMVDGLNGGLPSGLPMGRIWSEGLDYYGWIFYLSKYYEVLDTFIILAKGKPSSILQTY
HHSGAMMCMWAGMRFMSAPIWMFALVNALIHALMYTYYTLTTFNIKVSIGIKRTLTTLQITQFLLGAFFATLHLF
ITYLAPVTVNTRDGMPASPADSTIPVASGVFESVKQLLFGPVLNESSPAITVSSVPQSGMLTETVYVAQPCIVTR
GETFAIWLNTVYLAPLTYLFVSFFIASYVKRSKAGQKASGKPNRLDENVTMAEKAGWDAARGVGKVVYGSDGSNS
PVSPVSSASPASPISKSPTLPKRANGRARRRA
Coding >Ophio5|3957
ATGTTCTTCGCAAATACTCATCATGTCGCCGTCACGATGCCCTACTCTAGCCAATTCATCTTACCGCCCTCTGGT
CAAGCTGCGCCGCTCGCCCCGGCCCCGAGGCCTCTGTCTTTTCTGCGTCCCTTCAACATACCCGAAAATGTCTAC
ACCGCCGCCCTCGATGCCCGCGTCCCCCTGACGATAGCCACCATGTACGCCGTCTCGGCCACACTCCTCAGCTGG
TACAATCGCTCTCGCAACAAGCGGCCATGGGCCATCAGCAAGACGCGCCTCTTCTTCGCCTTTGTCGTCCTCCAC
AACGTCTTCCTCGCCCTCTACTCCGCCTGGACCTTCTGGGGCATGTTGGGCGTCATGCGTCGGAGCTTCCGCCAA
CCCTGGGGTCCCGGCGGCCTGCCGGCCATGCTCGATGGCTTCTGCCGAATGCACGGCCCGGGCCGTCTCGGATCA
TCCCTCTACTATCACGAGGCGTCGGGCCGCTGGCTGAGCGCCGACGCTTCTTCCATGGTCGATGGGCTCAACGGC
GGCCTGCCCAGCGGCCTCCCCATGGGCCGCATCTGGAGCGAGGGACTCGACTACTACGGCTGGATCTTCTACCTC
AGCAAGTACTACGAGGTGCTCGATACTTTCATCATTCTCGCCAAGGGCAAGCCCAGCTCCATCCTGCAGACCTAT
CACCACTCGGGTGCCATGATGTGCATGTGGGCAGGCATGCGCTTCATGTCTGCCCCCATCTGGATGTTTGCCCTT
GTCAACGCTCTGATTCACGCTCTAATGTACACCTATTACACCTTGACGACCTTTAACATCAAGGTGTCCATTGGC
ATCAAGCGCACGCTCACGACGCTGCAAATCACTCAGTTCCTTCTCGGCGCCTTCTTCGCCACGCTTCACCTCTTC
ATCACCTATCTTGCGCCCGTCACCGTCAATACGCGTGACGGCATGCCAGCCAGTCCTGCCGACTCCACCATCCCT
GTTGCCAGCGGTGTCTTCGAGTCGGTCAAGCAGCTTCTCTTCGGTCCCGTCCTCAACGAGAGCTCGCCGGCGATA
ACCGTCTCCTCGGTACCGCAATCGGGCATGCTCACCGAGACGGTGTACGTCGCCCAGCCGTGCATCGTCACTAGG
GGCGAGACGTTTGCCATCTGGCTCAACACGGTCTACCTGGCGCCCCTGACGTACCTGTTTGTGAGCTTCTTCATC
GCCAGCTACGTGAAGCGCAGCAAGGCCGGTCAAAAGGCCAGCGGCAAGCCCAATCGTCTGGACGAAAACGTCACC
ATGGCGGAAAAGGCCGGCTGGGATGCCGCTCGCGGCGTCGGAAAGGTCGTATACGGCTCCGACGGCAGCAACAGT
CCCGTCAGCCCCGTCAGTTCGGCCAGCCCTGCCAGCCCCATTTCCAAGAGCCCGACTCTGCCTAAGAGGGCCAAC
GGCAGGGCCAGGCGACGGGCC
Transcript >Ophio5|3957
ATGTTCTTCGCAAATACTCATCATGTCGCCGTCACGATGCCCTACTCTAGCCAATTCATCTTACCGCCCTCTGGT
CAAGCTGCGCCGCTCGCCCCGGCCCCGAGGCCTCTGTCTTTTCTGCGTCCCTTCAACATACCCGAAAATGTCTAC
ACCGCCGCCCTCGATGCCCGCGTCCCCCTGACGATAGCCACCATGTACGCCGTCTCGGCCACACTCCTCAGCTGG
TACAATCGCTCTCGCAACAAGCGGCCATGGGCCATCAGCAAGACGCGCCTCTTCTTCGCCTTTGTCGTCCTCCAC
AACGTCTTCCTCGCCCTCTACTCCGCCTGGACCTTCTGGGGCATGTTGGGCGTCATGCGTCGGAGCTTCCGCCAA
CCCTGGGGTCCCGGCGGCCTGCCGGCCATGCTCGATGGCTTCTGCCGAATGCACGGCCCGGGCCGTCTCGGATCA
TCCCTCTACTATCACGAGGCGTCGGGCCGCTGGCTGAGCGCCGACGCTTCTTCCATGGTCGATGGGCTCAACGGC
GGCCTGCCCAGCGGCCTCCCCATGGGCCGCATCTGGAGCGAGGGACTCGACTACTACGGCTGGATCTTCTACCTC
AGCAAGTACTACGAGGTGCTCGATACTTTCATCATTCTCGCCAAGGGCAAGCCCAGCTCCATCCTGCAGACCTAT
CACCACTCGGGTGCCATGATGTGCATGTGGGCAGGCATGCGCTTCATGTCTGCCCCCATCTGGATGTTTGCCCTT
GTCAACGCTCTGATTCACGCTCTAATGTACACCTATTACACCTTGACGACCTTTAACATCAAGGTGTCCATTGGC
ATCAAGCGCACGCTCACGACGCTGCAAATCACTCAGTTCCTTCTCGGCGCCTTCTTCGCCACGCTTCACCTCTTC
ATCACCTATCTTGCGCCCGTCACCGTCAATACGCGTGACGGCATGCCAGCCAGTCCTGCCGACTCCACCATCCCT
GTTGCCAGCGGTGTCTTCGAGTCGGTCAAGCAGCTTCTCTTCGGTCCCGTCCTCAACGAGAGCTCGCCGGCGATA
ACCGTCTCCTCGGTACCGCAATCGGGCATGCTCACCGAGACGGTGTACGTCGCCCAGCCGTGCATCGTCACTAGG
GGCGAGACGTTTGCCATCTGGCTCAACACGGTCTACCTGGCGCCCCTGACGTACCTGTTTGTGAGCTTCTTCATC
GCCAGCTACGTGAAGCGCAGCAAGGCCGGTCAAAAGGCCAGCGGCAAGCCCAATCGTCTGGACGAAAACGTCACC
ATGGCGGAAAAGGCCGGCTGGGATGCCGCTCGCGGCGTCGGAAAGGTCGTATACGGCTCCGACGGCAGCAACAGT
CCCGTCAGCCCCGTCAGTTCGGCCAGCCCTGCCAGCCCCATTTCCAAGAGCCCGACTCTGCCTAAGAGGGCCAAC
GGCAGGGCCAGGCGACGGGCCTGA
Gene >Ophio5|3957
ATGTTCTTCGCAAATACTCATCATGTCGCCGTCACGATGCCCTACTCTAGCCAATTCATCTTACCGCCCTCTGGT
CAAGCTGCGCCGCTCGCCCCGGCCCCGAGGCCTCTGTCTTTTCTGCGTCCCTTCAACATACCCGAAAATGTCTAC
ACCGCCGCCCTCGATGCCCGCGTCCCCCTGACGATAGCCACCATGTACGCCGTCTCGGCCACACTCCTCAGCTGG
TACAATCGCTCTCGCAACAAGCGGCCATGGGCCATCAGCAAGACGCGCCTCTTCTTCGCCTTTGTCGTCCTCCAC
AACGTCTTCCTCGCCCTCTACTCCGCCTGGACCTTCTGGGGCATGTTGGGCGTCATGCGTCGGAGCTTCCGCCAA
CCCTGGGGTCCCGGCGGCCTGCCGGCCATGCTCGATGGCTTCTGCCGAATGCACGGCCCGGGCCGTCTCGGATCA
TCCCTCTACTATCACGAGGCGTCGGGCCGCTGGCTGAGCGCCGACGCTTCTTCCATGGTCGATGGGCTCAACGGC
GGCCTGCCCAGCGGCCTCCCCATGGGCCGCATCTGGAGCGAGGGACTCGACTACTACGGCTGGATCTTCTACCTC
AGCAAGTACTACGAGGTGCTCGATACTTTCATCATTCTCGCCAAGGGCAAGCCCAGCTCCATCCTGCAGACCTAT
CACCACTCGGGTGCCATGATGTGCATGTGGGCAGGCATGCGCTTCATGTCTGCCCCCATCTGGATGTTTGCCCTT
GTCAACGCTCTGATTCACGCTCTAATGGTGACTTCCCTGACTCCTGCAAGCAACAACACCCGCTGACCTTTGATA
TTCTTCAGTACACCTATTACACCTTGACGACCTTTAACATCAAGGTGTCCATTGGCATCAAGCGCACGCTCACGA
CGCTGCAAATCACTCAGTTCCTTCTCGGCGCCTTCTTCGCCACGCTTCACCTCTTCATCACCTATCTTGCGCCCG
TCACCGTCAATACGCGTGACGGCATGCCAGCCAGTCCTGCCGACTCCACCATCCCTGTTGCCAGCGGTGTCTTCG
AGTCGGTCAAGCAGCTTCTCTTCGGTCCCGTCCTCAACGAGAGCTCGCCGGCGATAACCGTCTCCTCGGTACCGC
AATCGGGCATGCTCACCGAGACGGTGTACGTCGCCCAGCCGTGCATCGTCACTAGGGGCGAGACGTTTGCCATCT
GGCTCAACACGGTCTACCTGGCGCCCCTGACGTACCTGTTTGTGAGCTTCTTCATCGCCAGCTACGTGAAGCGCA
GCAAGGCCGGTCAAAAGGCCAGCGGCAAGCCCAATCGTCTGGACGAAAACGTCACCATGGCGGAAAAGGCCGGCT
GGGATGCCGCTCGCGGCGTCGGAAAGGTCGTATACGGCTCCGACGGCAGCAACAGTCCCGTCAGCCCCGTCAGTT
CGGCCAGCCCTGCCAGCCCCATTTCCAAGAGCCCGACTCTGCCTAAGAGGGCCAACGGCAGGGCCAGGCGACGGG
CCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail