Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3954
Gene name
Locationscaffold_309:8698..9646
Strand-
Gene length (bp)948
Transcript length (bp)948
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09377 SBDS_domain_II SBDS protein, domain II 6.3E-35 112 214
PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein 3.8E-33 16 103
PF20268 SBDS_C SBDS protein, C-terminal domain 2.9E-25 216 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14179|SDO1_SCHPO Ribosome maturation protein sdo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdo1 PE=3 SV=1 5 310 9.0E-61
sp|Q6DIT8|SBDS_XENTR Ribosome maturation protein SBDS OS=Xenopus tropicalis GN=sbds PE=2 SV=1 5 309 5.0E-58
sp|A5D8M6|SBDS_XENLA Ribosome maturation protein SBDS OS=Xenopus laevis GN=sbds PE=2 SV=1 5 309 4.0E-57
sp|P70122|SBDS_MOUSE Ribosome maturation protein SBDS OS=Mus musculus GN=Sbds PE=1 SV=4 5 309 1.0E-55
sp|Q5RK30|SBDS_RAT Ribosome maturation protein SBDS OS=Rattus norvegicus GN=Sbds PE=2 SV=1 5 309 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14179|SDO1_SCHPO Ribosome maturation protein sdo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdo1 PE=3 SV=1 5 310 9.0E-61
sp|Q6DIT8|SBDS_XENTR Ribosome maturation protein SBDS OS=Xenopus tropicalis GN=sbds PE=2 SV=1 5 309 5.0E-58
sp|A5D8M6|SBDS_XENLA Ribosome maturation protein SBDS OS=Xenopus laevis GN=sbds PE=2 SV=1 5 309 4.0E-57
sp|P70122|SBDS_MOUSE Ribosome maturation protein SBDS OS=Mus musculus GN=Sbds PE=1 SV=4 5 309 1.0E-55
sp|Q5RK30|SBDS_RAT Ribosome maturation protein SBDS OS=Rattus norvegicus GN=Sbds PE=2 SV=1 5 309 2.0E-55
sp|Q5RAZ2|SBDS_PONAB Ribosome maturation protein SBDS OS=Pongo abelii GN=SBDS PE=2 SV=1 5 309 4.0E-55
sp|Q9Y3A5|SBDS_HUMAN Ribosome maturation protein SBDS OS=Homo sapiens GN=SBDS PE=1 SV=4 5 309 4.0E-55
sp|Q3SWZ6|SBDS_BOVIN Ribosome maturation protein SBDS OS=Bos taurus GN=SBDS PE=2 SV=1 5 309 4.0E-55
sp|Q07953|SDO1_YEAST Ribosome maturation protein SDO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDO1 PE=1 SV=1 5 311 1.0E-53
sp|Q5ZIY4|SBDS_CHICK Ribosome maturation protein SBDS OS=Gallus gallus GN=SBDS PE=2 SV=1 5 309 2.0E-52
sp|Q23202|SBDS_CAEEL Ribosome maturation protein SBDS OS=Caenorhabditis elegans GN=sbds-1 PE=3 SV=2 1 309 2.0E-50
sp|Q86KZ5|SBDS_DICDI Ribosome maturation protein SBDS OS=Dictyostelium discoideum GN=sbds PE=3 SV=2 5 311 1.0E-45
sp|Q8SUL0|SDO1_ENCCU Ribosome maturation protein SDO1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SDO1 PE=1 SV=1 8 122 2.0E-15
sp|Q9YCU5|SDO1_AERPE Ribosome maturation protein SDO1 homolog OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1167.1 PE=3 SV=2 27 141 1.0E-09
sp|O29759|SDO1_ARCFU Ribosome maturation protein SDO1 homolog OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0491 PE=1 SV=1 11 141 9.0E-09
sp|Q9V121|SDO1_PYRAB Ribosome maturation protein SDO1 homolog OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06080 PE=3 SV=1 21 127 2.0E-08
sp|Q58011|SDO1_METJA Ribosome maturation protein SDO1 homolog OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0592 PE=3 SV=1 12 143 4.0E-08
sp|O59220|SDO1_PYRHO Ribosome maturation protein SDO1 homolog OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1552 PE=3 SV=1 21 127 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0044085 cellular component biogenesis No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3954
MSRQINQPSNQIKLTNVSFVRLKKGKKRFEIACYKNKVLEWRSGIETDLDNVLQIPNVFLNVSKGQTAPKEDLEK
AFGKGKPTADIILEILTKGELQVGNKERAAQLERVHNEVVAIVASKLVDPRTKRVYTSGIIEKALDMLSSQAHAG
SDKGNAAPTPPAAADADADIDAETKPRPKEHSWTGVVTTKSAKSQALDAIKALIASQPIPVARARMRLRVTCATG
VLKQAVKSTAGKGAPKDDDDESEQKTPGTVKDRILAFYEQVESQDVTGSEWEAVGFVEPGAFKGLSDIIANETKG
QGRVEVLDMAVTHQI
Coding >Ophio5|3954
ATGTCGCGCCAGATCAACCAGCCCTCCAACCAAATCAAGCTCACCAATGTCTCCTTTGTGCGTCTGAAGAAGGGC
AAAAAGCGGTTTGAAATCGCGTGCTACAAGAACAAAGTCCTCGAATGGCGCTCCGGCATAGAGACAGACCTCGAC
AACGTGCTGCAGATCCCCAACGTCTTCCTCAACGTCTCTAAAGGCCAGACGGCGCCCAAGGAGGATCTCGAAAAG
GCCTTTGGCAAGGGAAAGCCCACCGCCGACATCATCCTCGAGATCCTCACAAAGGGCGAGCTGCAGGTCGGCAAC
AAGGAGCGCGCCGCTCAGCTTGAGCGCGTTCACAATGAGGTCGTCGCCATAGTCGCCAGCAAGCTCGTCGACCCT
CGCACAAAGCGCGTCTACACCTCCGGCATCATCGAAAAGGCCCTCGACATGCTGAGCTCACAGGCCCATGCCGGC
TCCGACAAGGGCAACGCCGCTCCGACACCTCCGGCCGCCGCCGATGCCGATGCCGATATCGACGCCGAGACGAAG
CCGCGACCCAAGGAGCACAGCTGGACCGGCGTAGTCACCACCAAGAGCGCAAAGAGCCAGGCCCTCGACGCCATC
AAGGCGCTCATCGCCAGTCAACCCATTCCCGTCGCCCGGGCCCGCATGAGGCTACGCGTGACGTGCGCCACTGGC
GTCCTCAAGCAGGCCGTGAAATCCACCGCCGGCAAAGGCGCTCCCAAGGACGACGACGACGAGAGCGAGCAGAAG
ACGCCTGGGACGGTCAAGGATAGGATTCTCGCGTTCTATGAGCAAGTGGAGAGTCAAGATGTGACGGGCTCCGAG
TGGGAGGCCGTTGGCTTTGTCGAGCCCGGCGCTTTCAAGGGCTTGTCGGATATCATTGCCAACGAGACCAAGGGA
CAAGGCCGGGTAGAGGTGTTGGACATGGCAGTCACGCATCAAATA
Transcript >Ophio5|3954
ATGTCGCGCCAGATCAACCAGCCCTCCAACCAAATCAAGCTCACCAATGTCTCCTTTGTGCGTCTGAAGAAGGGC
AAAAAGCGGTTTGAAATCGCGTGCTACAAGAACAAAGTCCTCGAATGGCGCTCCGGCATAGAGACAGACCTCGAC
AACGTGCTGCAGATCCCCAACGTCTTCCTCAACGTCTCTAAAGGCCAGACGGCGCCCAAGGAGGATCTCGAAAAG
GCCTTTGGCAAGGGAAAGCCCACCGCCGACATCATCCTCGAGATCCTCACAAAGGGCGAGCTGCAGGTCGGCAAC
AAGGAGCGCGCCGCTCAGCTTGAGCGCGTTCACAATGAGGTCGTCGCCATAGTCGCCAGCAAGCTCGTCGACCCT
CGCACAAAGCGCGTCTACACCTCCGGCATCATCGAAAAGGCCCTCGACATGCTGAGCTCACAGGCCCATGCCGGC
TCCGACAAGGGCAACGCCGCTCCGACACCTCCGGCCGCCGCCGATGCCGATGCCGATATCGACGCCGAGACGAAG
CCGCGACCCAAGGAGCACAGCTGGACCGGCGTAGTCACCACCAAGAGCGCAAAGAGCCAGGCCCTCGACGCCATC
AAGGCGCTCATCGCCAGTCAACCCATTCCCGTCGCCCGGGCCCGCATGAGGCTACGCGTGACGTGCGCCACTGGC
GTCCTCAAGCAGGCCGTGAAATCCACCGCCGGCAAAGGCGCTCCCAAGGACGACGACGACGAGAGCGAGCAGAAG
ACGCCTGGGACGGTCAAGGATAGGATTCTCGCGTTCTATGAGCAAGTGGAGAGTCAAGATGTGACGGGCTCCGAG
TGGGAGGCCGTTGGCTTTGTCGAGCCCGGCGCTTTCAAGGGCTTGTCGGATATCATTGCCAACGAGACCAAGGGA
CAAGGCCGGGTAGAGGTGTTGGACATGGCAGTCACGCATCAAATATAG
Gene >Ophio5|3954
ATGTCGCGCCAGATCAACCAGCCCTCCAACCAAATCAAGCTCACCAATGTCTCCTTTGTGCGTCTGAAGAAGGGC
AAAAAGCGGTTTGAAATCGCGTGCTACAAGAACAAAGTCCTCGAATGGCGCTCCGGCATAGAGACAGACCTCGAC
AACGTGCTGCAGATCCCCAACGTCTTCCTCAACGTCTCTAAAGGCCAGACGGCGCCCAAGGAGGATCTCGAAAAG
GCCTTTGGCAAGGGAAAGCCCACCGCCGACATCATCCTCGAGATCCTCACAAAGGGCGAGCTGCAGGTCGGCAAC
AAGGAGCGCGCCGCTCAGCTTGAGCGCGTTCACAATGAGGTCGTCGCCATAGTCGCCAGCAAGCTCGTCGACCCT
CGCACAAAGCGCGTCTACACCTCCGGCATCATCGAAAAGGCCCTCGACATGCTGAGCTCACAGGCCCATGCCGGC
TCCGACAAGGGCAACGCCGCTCCGACACCTCCGGCCGCCGCCGATGCCGATGCCGATATCGACGCCGAGACGAAG
CCGCGACCCAAGGAGCACAGCTGGACCGGCGTAGTCACCACCAAGAGCGCAAAGAGCCAGGCCCTCGACGCCATC
AAGGCGCTCATCGCCAGTCAACCCATTCCCGTCGCCCGGGCCCGCATGAGGCTACGCGTGACGTGCGCCACTGGC
GTCCTCAAGCAGGCCGTGAAATCCACCGCCGGCAAAGGCGCTCCCAAGGACGACGACGACGAGAGCGAGCAGAAG
ACGCCTGGGACGGTCAAGGATAGGATTCTCGCGTTCTATGAGCAAGTGGAGAGTCAAGATGTGACGGGCTCCGAG
TGGGAGGCCGTTGGCTTTGTCGAGCCCGGCGCTTTCAAGGGCTTGTCGGATATCATTGCCAACGAGACCAAGGGA
CAAGGCCGGGTAGAGGTGTTGGACATGGCAGTCACGCATCAAATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail