Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3950
Gene name
Locationscaffold_309:350..2093
Strand-
Gene length (bp)1743
Transcript length (bp)1743
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 4.1E-10 63 254
PF03209 PUCC PUCC protein 1.1E-04 77 187

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14091|SUT1_SCHPO General alpha-glucoside permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sut1 PE=3 SV=1 11 559 1.0E-77
sp|Q10R54|SUT1_ORYSJ Sucrose transport protein SUT1 OS=Oryza sativa subsp. japonica GN=SUT1 PE=1 SV=1 47 348 4.0E-36
sp|Q9LKH3|SUT1_ORYSI Sucrose transport protein SUT1 OS=Oryza sativa subsp. indica GN=SUT1 PE=3 SV=1 47 348 4.0E-36
sp|Q9FG00|SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1 48 348 6.0E-34
sp|O80605|SUC3_ARATH Sucrose transport protein SUC3 OS=Arabidopsis thaliana GN=SUC3 PE=1 SV=1 48 348 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14091|SUT1_SCHPO General alpha-glucoside permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sut1 PE=3 SV=1 11 559 1.0E-77
sp|Q10R54|SUT1_ORYSJ Sucrose transport protein SUT1 OS=Oryza sativa subsp. japonica GN=SUT1 PE=1 SV=1 47 348 4.0E-36
sp|Q9LKH3|SUT1_ORYSI Sucrose transport protein SUT1 OS=Oryza sativa subsp. indica GN=SUT1 PE=3 SV=1 47 348 4.0E-36
sp|Q9FG00|SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1 48 348 6.0E-34
sp|O80605|SUC3_ARATH Sucrose transport protein SUC3 OS=Arabidopsis thaliana GN=SUC3 PE=1 SV=1 48 348 2.0E-32
sp|Q67YF8|SUC7_ARATH Sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=2 SV=2 48 348 5.0E-31
sp|Q39231|SUC2_ARATH Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2 48 348 9.0E-31
sp|Q6A329|SUC6_ARATH Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2 48 348 3.0E-30
sp|Q6YK44|SUT4_ORYSJ Sucrose transport protein SUT4 OS=Oryza sativa subsp. japonica GN=SUT4 PE=2 SV=1 14 348 4.0E-30
sp|B8AF63|SUT4_ORYSI Sucrose transport protein SUT4 OS=Oryza sativa subsp. indica GN=SUT4 PE=3 SV=1 14 348 4.0E-30
sp|Q39232|SUC1_ARATH Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1 13 415 7.0E-30
sp|Q948L0|SUT3_ORYSJ Sucrose transport protein SUT3 OS=Oryza sativa subsp. japonica GN=SUT3 PE=2 SV=1 47 356 1.0E-29
sp|Q9C8X2|SUC5_ARATH Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1 48 348 2.0E-29
sp|Q9ZVK6|SUC8_ARATH Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1 48 348 2.0E-29
sp|Q944W2|SUT3_ORYSI Sucrose transport protein SUT3 OS=Oryza sativa subsp. indica GN=SUT3 PE=3 SV=1 47 356 3.0E-29
sp|Q0ILJ3|SUT2_ORYSJ Sucrose transport protein SUT2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2 48 356 9.0E-28
sp|A2ZN77|SUT2_ORYSI Sucrose transport protein SUT2 OS=Oryza sativa subsp. indica GN=SUT2 PE=2 SV=2 48 356 1.0E-27
sp|Q03411|SUT_SPIOL Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1 48 348 1.0E-27
sp|Q69JW3|SUT5_ORYSJ Sucrose transport protein SUT5 OS=Oryza sativa subsp. japonica GN=SUT5 PE=1 SV=1 47 357 2.0E-27
sp|A2X6E6|SUT5_ORYSI Sucrose transport protein SUT5 OS=Oryza sativa subsp. indica GN=SUT5 PE=3 SV=1 47 357 3.0E-27
sp|Q9FE59|SUC4_ARATH Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2 48 356 5.0E-24
sp|P58355|S45A2_MOUSE Membrane-associated transporter protein OS=Mus musculus GN=Slc45a2 PE=1 SV=1 17 355 2.0E-20
sp|Q9UMX9|S45A2_HUMAN Membrane-associated transporter protein OS=Homo sapiens GN=SLC45A2 PE=1 SV=2 22 349 8.0E-20
sp|Q4LE88|S45A2_PIG Membrane-associated transporter protein OS=Sus scrofa GN=SLC45A2 PE=2 SV=2 39 355 4.0E-16
sp|Q5BKX6|S45A4_HUMAN Solute carrier family 45 member 4 OS=Homo sapiens GN=SLC45A4 PE=1 SV=2 48 263 8.0E-16
sp|Q0P5V9|S45A4_MOUSE Solute carrier family 45 member 4 OS=Mus musculus GN=Slc45a4 PE=1 SV=1 48 263 1.0E-14
sp|Q96JT2|S45A3_HUMAN Solute carrier family 45 member 3 OS=Homo sapiens GN=SLC45A3 PE=2 SV=1 37 350 2.0E-14
sp|Q8K0H7|S45A3_MOUSE Solute carrier family 45 member 3 OS=Mus musculus GN=Slc45a3 PE=2 SV=1 37 350 1.0E-13
sp|Q95KI5|S45A3_MACFA Solute carrier family 45 member 3 OS=Macaca fascicularis GN=SLC45A3 PE=2 SV=1 37 350 1.0E-12
sp|Q9Y2W3|S45A1_HUMAN Proton-associated sugar transporter A OS=Homo sapiens GN=SLC45A1 PE=2 SV=4 48 187 2.0E-10
sp|Q8K4S3|S45A1_RAT Proton-associated sugar transporter A OS=Rattus norvegicus GN=Slc45a1 PE=2 SV=1 23 193 9.0E-10
sp|Q8BIV7|S45A1_MOUSE Proton-associated sugar transporter A OS=Mus musculus GN=Slc45a1 PE=1 SV=3 48 187 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 34 53 19
2 73 95 22
3 108 127 19
4 147 169 22
5 192 209 17
6 224 246 22
7 290 312 22
8 337 359 22
9 405 427 22
10 432 454 22
11 542 564 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 91.77 49.38 134.16
CcL In ants, during behavior modification 57.41 31.07 83.75
CcD In ants, recently dead 60.59 32.79 88.38

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.033161 yes
SC16a CcD 0.069876 no
CcL CcD 0.849662 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3950
MSLPSAAPADEVAPLLGSERPPDDDDDAPLSPWYNALYVTLLTLGFGGLQIAWSVELSHGSPYLLSLGLSKSLMA
LVWIAGPLTGSLVVPYVGILSDNCRLPWGRRRPYLVGGTVGTIFSLLFLAWAREIVAGILALFGADAGSEGVRIA
VIAFAVVGIYLVDISINTVQAALRAFIVDCAPPGQQELANSMAGRLTGVGNIIGYLAGYSNLPARMPFLGDTQFK
ILCAIASLALCVTIAISVSFIRERDPRAEGRPPAKTPGIGPFFFNVMRSIRRLPPQTKSVCRVQFCAWVGFFPLL
FYSSSYIAEIYVQPFLRAKPDMTREEIEVLYQQATRIGTLALLINAIVSLSTNVFLPFFITPSLDTTRRLPFTTG
GGVSKSDEDDRSSSLARWLRIPGLTVKRAWIGSLVLFAVVMFCCPLVNSVEAATGLIGVAGITWAMALWAPWAII
GAEISRRDALARARKPGDDGRGGPGHGTSTTPGEGAATTEDEVEDEEADDQAGVVLGIHNMAIAVPQIVATVGSS
IIFKIWQKPRGIAGDHSIAVVMALGGVCVLLSVFFAAGIDDESELPDAERGSDTG
Coding >Ophio5|3950
ATGTCACTCCCTTCTGCAGCGCCAGCCGACGAGGTCGCGCCCCTCCTCGGCTCCGAACGGCCACCCGACGACGAC
GACGATGCGCCGCTTAGCCCCTGGTACAACGCCTTGTACGTCACGCTTTTGACGCTGGGCTTCGGGGGCCTCCAG
ATCGCCTGGTCGGTGGAGCTGTCGCATGGCTCGCCCTATCTGCTGTCGCTGGGCCTCAGCAAGTCGCTCATGGCG
CTGGTGTGGATCGCCGGCCCCTTGACCGGCTCGCTGGTGGTGCCGTACGTCGGTATCCTGAGCGATAACTGCCGT
CTGCCCTGGGGCCGTCGGAGACCGTATCTCGTCGGCGGCACTGTCGGAACCATCTTCTCGCTGCTCTTCCTAGCC
TGGGCGCGCGAGATCGTTGCTGGCATCCTGGCGCTTTTCGGCGCCGATGCCGGCTCCGAAGGCGTCCGCATCGCC
GTCATCGCCTTTGCTGTTGTCGGCATCTACCTTGTCGATATTTCCATCAATACCGTCCAGGCCGCTCTACGCGCC
TTCATCGTCGACTGTGCCCCCCCTGGCCAGCAGGAGCTCGCCAACAGCATGGCCGGCCGCCTCACGGGCGTCGGT
AACATCATCGGTTATCTGGCCGGCTATTCCAATCTCCCCGCCCGGATGCCGTTCCTGGGCGATACGCAGTTCAAG
ATCCTCTGCGCCATCGCCTCCCTGGCCCTGTGCGTCACCATCGCCATCAGCGTCTCTTTCATCAGGGAGAGGGAT
CCCCGCGCCGAGGGGCGTCCGCCCGCCAAGACGCCTGGCATTGGTCCCTTCTTCTTCAACGTGATGCGCTCTATT
AGACGGCTGCCGCCACAGACCAAAAGCGTCTGCCGCGTGCAATTCTGCGCTTGGGTCGGCTTCTTCCCCTTGCTC
TTCTACTCTTCGTCGTACATTGCCGAGATTTACGTCCAGCCCTTTCTACGAGCCAAACCTGACATGACGAGGGAA
GAGATCGAAGTGCTCTATCAACAGGCGACGCGCATAGGCACCCTAGCCCTCCTTATCAACGCCATCGTCAGTCTG
TCGACCAATGTATTTCTACCTTTTTTCATCACCCCAAGTCTTGACACCACCCGTCGCCTTCCCTTCACAACCGGC
GGCGGCGTGTCCAAGTCGGACGAGGACGACCGCAGCTCCTCCTTGGCTCGCTGGCTGAGAATCCCGGGCTTGACG
GTCAAACGGGCGTGGATAGGCTCGCTGGTACTGTTCGCCGTCGTCATGTTTTGTTGCCCCCTTGTCAACTCGGTC
GAGGCAGCGACGGGCCTCATCGGCGTGGCGGGCATCACCTGGGCCATGGCTCTATGGGCGCCATGGGCCATCATC
GGCGCCGAAATCAGCCGGCGCGATGCCCTCGCCCGGGCGCGGAAGCCGGGTGACGATGGTCGGGGCGGCCCAGGA
CACGGAACGTCTACTACGCCTGGCGAGGGCGCAGCCACGACAGAAGACGAAGTCGAAGACGAAGAGGCCGACGAC
CAGGCGGGCGTTGTCCTGGGCATCCACAACATGGCCATCGCCGTGCCGCAGATTGTAGCGACGGTGGGCTCGAGC
ATCATCTTCAAGATCTGGCAGAAGCCGCGCGGCATAGCGGGGGATCACAGCATCGCCGTCGTCATGGCGCTCGGC
GGTGTGTGCGTCTTGCTCTCCGTCTTCTTCGCCGCGGGAATCGACGATGAGAGCGAGTTGCCAGACGCGGAGCGG
GGGAGTGACACTGGG
Transcript >Ophio5|3950
ATGTCACTCCCTTCTGCAGCGCCAGCCGACGAGGTCGCGCCCCTCCTCGGCTCCGAACGGCCACCCGACGACGAC
GACGATGCGCCGCTTAGCCCCTGGTACAACGCCTTGTACGTCACGCTTTTGACGCTGGGCTTCGGGGGCCTCCAG
ATCGCCTGGTCGGTGGAGCTGTCGCATGGCTCGCCCTATCTGCTGTCGCTGGGCCTCAGCAAGTCGCTCATGGCG
CTGGTGTGGATCGCCGGCCCCTTGACCGGCTCGCTGGTGGTGCCGTACGTCGGTATCCTGAGCGATAACTGCCGT
CTGCCCTGGGGCCGTCGGAGACCGTATCTCGTCGGCGGCACTGTCGGAACCATCTTCTCGCTGCTCTTCCTAGCC
TGGGCGCGCGAGATCGTTGCTGGCATCCTGGCGCTTTTCGGCGCCGATGCCGGCTCCGAAGGCGTCCGCATCGCC
GTCATCGCCTTTGCTGTTGTCGGCATCTACCTTGTCGATATTTCCATCAATACCGTCCAGGCCGCTCTACGCGCC
TTCATCGTCGACTGTGCCCCCCCTGGCCAGCAGGAGCTCGCCAACAGCATGGCCGGCCGCCTCACGGGCGTCGGT
AACATCATCGGTTATCTGGCCGGCTATTCCAATCTCCCCGCCCGGATGCCGTTCCTGGGCGATACGCAGTTCAAG
ATCCTCTGCGCCATCGCCTCCCTGGCCCTGTGCGTCACCATCGCCATCAGCGTCTCTTTCATCAGGGAGAGGGAT
CCCCGCGCCGAGGGGCGTCCGCCCGCCAAGACGCCTGGCATTGGTCCCTTCTTCTTCAACGTGATGCGCTCTATT
AGACGGCTGCCGCCACAGACCAAAAGCGTCTGCCGCGTGCAATTCTGCGCTTGGGTCGGCTTCTTCCCCTTGCTC
TTCTACTCTTCGTCGTACATTGCCGAGATTTACGTCCAGCCCTTTCTACGAGCCAAACCTGACATGACGAGGGAA
GAGATCGAAGTGCTCTATCAACAGGCGACGCGCATAGGCACCCTAGCCCTCCTTATCAACGCCATCGTCAGTCTG
TCGACCAATGTATTTCTACCTTTTTTCATCACCCCAAGTCTTGACACCACCCGTCGCCTTCCCTTCACAACCGGC
GGCGGCGTGTCCAAGTCGGACGAGGACGACCGCAGCTCCTCCTTGGCTCGCTGGCTGAGAATCCCGGGCTTGACG
GTCAAACGGGCGTGGATAGGCTCGCTGGTACTGTTCGCCGTCGTCATGTTTTGTTGCCCCCTTGTCAACTCGGTC
GAGGCAGCGACGGGCCTCATCGGCGTGGCGGGCATCACCTGGGCCATGGCTCTATGGGCGCCATGGGCCATCATC
GGCGCCGAAATCAGCCGGCGCGATGCCCTCGCCCGGGCGCGGAAGCCGGGTGACGATGGTCGGGGCGGCCCAGGA
CACGGAACGTCTACTACGCCTGGCGAGGGCGCAGCCACGACAGAAGACGAAGTCGAAGACGAAGAGGCCGACGAC
CAGGCGGGCGTTGTCCTGGGCATCCACAACATGGCCATCGCCGTGCCGCAGATTGTAGCGACGGTGGGCTCGAGC
ATCATCTTCAAGATCTGGCAGAAGCCGCGCGGCATAGCGGGGGATCACAGCATCGCCGTCGTCATGGCGCTCGGC
GGTGTGTGCGTCTTGCTCTCCGTCTTCTTCGCCGCGGGAATCGACGATGAGAGCGAGTTGCCAGACGCGGAGCGG
GGGAGTGACACTGGGTGA
Gene >Ophio5|3950
ATGTCACTCCCTTCTGCAGCGCCAGCCGACGAGGTCGCGCCCCTCCTCGGCTCCGAACGGCCACCCGACGACGAC
GACGATGCGCCGCTTAGCCCCTGGTACAACGCCTTGTACGTCACGCTTTTGACGCTGGGCTTCGGGGGCCTCCAG
ATCGCCTGGTCGGTGGAGCTGTCGCATGGCTCGCCCTATCTGCTGTCGCTGGGCCTCAGCAAGTCGCTCATGGCG
CTGGTGTGGATCGCCGGCCCCTTGACCGGCTCGCTGGTGGTGCCGTACGTCGGTATCCTGAGCGATAACTGCCGT
CTGCCCTGGGGCCGTCGGAGACCGTATCTCGTCGGCGGCACTGTCGGAACCATCTTCTCGCTGCTCTTCCTAGCC
TGGGCGCGCGAGATCGTTGCTGGCATCCTGGCGCTTTTCGGCGCCGATGCCGGCTCCGAAGGCGTCCGCATCGCC
GTCATCGCCTTTGCTGTTGTCGGCATCTACCTTGTCGATATTTCCATCAATACCGTCCAGGCCGCTCTACGCGCC
TTCATCGTCGACTGTGCCCCCCCTGGCCAGCAGGAGCTCGCCAACAGCATGGCCGGCCGCCTCACGGGCGTCGGT
AACATCATCGGTTATCTGGCCGGCTATTCCAATCTCCCCGCCCGGATGCCGTTCCTGGGCGATACGCAGTTCAAG
ATCCTCTGCGCCATCGCCTCCCTGGCCCTGTGCGTCACCATCGCCATCAGCGTCTCTTTCATCAGGGAGAGGGAT
CCCCGCGCCGAGGGGCGTCCGCCCGCCAAGACGCCTGGCATTGGTCCCTTCTTCTTCAACGTGATGCGCTCTATT
AGACGGCTGCCGCCACAGACCAAAAGCGTCTGCCGCGTGCAATTCTGCGCTTGGGTCGGCTTCTTCCCCTTGCTC
TTCTACTCTTCGTCGTACATTGCCGAGATTTACGTCCAGCCCTTTCTACGAGCCAAACCTGACATGACGAGGGAA
GAGATCGAAGTGCTCTATCAACAGGCGACGCGCATAGGCACCCTAGCCCTCCTTATCAACGCCATCGTCAGTCTG
TCGACCAATGTATTTCTACCTTTTTTCATCACCCCAAGTCTTGACACCACCCGTCGCCTTCCCTTCACAACCGGC
GGCGGCGTGTCCAAGTCGGACGAGGACGACCGCAGCTCCTCCTTGGCTCGCTGGCTGAGAATCCCGGGCTTGACG
GTCAAACGGGCGTGGATAGGCTCGCTGGTACTGTTCGCCGTCGTCATGTTTTGTTGCCCCCTTGTCAACTCGGTC
GAGGCAGCGACGGGCCTCATCGGCGTGGCGGGCATCACCTGGGCCATGGCTCTATGGGCGCCATGGGCCATCATC
GGCGCCGAAATCAGCCGGCGCGATGCCCTCGCCCGGGCGCGGAAGCCGGGTGACGATGGTCGGGGCGGCCCAGGA
CACGGAACGTCTACTACGCCTGGCGAGGGCGCAGCCACGACAGAAGACGAAGTCGAAGACGAAGAGGCCGACGAC
CAGGCGGGCGTTGTCCTGGGCATCCACAACATGGCCATCGCCGTGCCGCAGATTGTAGCGACGGTGGGCTCGAGC
ATCATCTTCAAGATCTGGCAGAAGCCGCGCGGCATAGCGGGGGATCACAGCATCGCCGTCGTCATGGCGCTCGGC
GGTGTGTGCGTCTTGCTCTCCGTCTTCTTCGCCGCGGGAATCGACGATGAGAGCGAGTTGCCAGACGCGGAGCGG
GGGAGTGACACTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail