Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3948
Gene name
Locationscaffold_308:20868..21490
Strand+
Gene length (bp)622
Transcript length (bp)552
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 5.3E-08 43 83
PF01476 LysM LysM domain 9.9E-02 122 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 166 9.0E-36
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 164 8.0E-35
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 24 164 2.0E-32
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 51 164 2.0E-16
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 1 164 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 166 9.0E-36
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 164 8.0E-35
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 24 164 2.0E-32
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 51 164 2.0E-16
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 1 164 2.0E-15
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 49 165 8.0E-12
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 116 165 1.0E-08
sp|D4B4Q2|LYSM4_ARTBC LysM domain-containing protein ARB_03442 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03442 PE=3 SV=2 97 168 4.0E-07
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 107 168 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3948
MHLHALALTLLCSLSSVGVAALSSIETPRPSLPDMIQGCHAFYYVRKGDTCGSIAAKNFISISQIRRWNPSVGNR
CENLRSDQYACIAGPDAPVPPSPPIPVPTPRPIQPGMIDGCRRFHFVVRGETCITVGDVYGVSFADLLKWNPAIG
PECANMWADTFLCVGTASSQSAEDSHDNLPKCD
Coding >Ophio5|3948
ATGCATCTCCACGCCCTTGCCCTAACGCTGCTCTGCAGCCTCAGCAGCGTCGGCGTCGCCGCCTTGTCCTCCATC
GAAACTCCCCGGCCTTCACTCCCGGACATGATCCAAGGCTGCCACGCCTTCTACTATGTCAGGAAAGGAGATACG
TGCGGGTCCATCGCGGCGAAAAACTTCATCTCCATCAGCCAAATTCGGCGTTGGAACCCAAGCGTCGGCAACCGC
TGCGAGAATCTCCGTTCTGATCAGTACGCCTGCATCGCTGGCCCGGACGCCCCCGTTCCGCCCTCACCCCCGATC
CCGGTGCCGACCCCGAGGCCTATCCAGCCCGGCATGATCGACGGCTGTCGCCGCTTCCATTTCGTCGTTCGAGGC
GAGACGTGTATCACCGTCGGGGACGTCTATGGCGTTTCCTTCGCCGATTTGCTCAAATGGAACCCGGCTATTGGG
CCCGAGTGCGCCAATATGTGGGCGGATACCTTCTTGTGTGTGGGCACGGCGAGCAGTCAGTCAGCTGAAGACTCT
CATGACAATCTTCCCAAGTGCGAC
Transcript >Ophio5|3948
ATGCATCTCCACGCCCTTGCCCTAACGCTGCTCTGCAGCCTCAGCAGCGTCGGCGTCGCCGCCTTGTCCTCCATC
GAAACTCCCCGGCCTTCACTCCCGGACATGATCCAAGGCTGCCACGCCTTCTACTATGTCAGGAAAGGAGATACG
TGCGGGTCCATCGCGGCGAAAAACTTCATCTCCATCAGCCAAATTCGGCGTTGGAACCCAAGCGTCGGCAACCGC
TGCGAGAATCTCCGTTCTGATCAGTACGCCTGCATCGCTGGCCCGGACGCCCCCGTTCCGCCCTCACCCCCGATC
CCGGTGCCGACCCCGAGGCCTATCCAGCCCGGCATGATCGACGGCTGTCGCCGCTTCCATTTCGTCGTTCGAGGC
GAGACGTGTATCACCGTCGGGGACGTCTATGGCGTTTCCTTCGCCGATTTGCTCAAATGGAACCCGGCTATTGGG
CCCGAGTGCGCCAATATGTGGGCGGATACCTTCTTGTGTGTGGGCACGGCGAGCAGTCAGTCAGCTGAAGACTCT
CATGACAATCTTCCCAAGTGCGACTGA
Gene >Ophio5|3948
ATGCATCTCCACGCCCTTGCCCTAACGCTGCTCTGCAGCCTCAGCAGCGTCGGCGTCGCCGCCTTGTCCTCCATC
GAAACTCCCCGGCCTTCACTCCCGGACATGATCCAAGGCTGCCACGCCTTCTACTATGTCAGGAAAGGAGATACG
TGCGGGTCCATCGCGGCGAAAAACTTCATCTCCATCAGCCAAATTCGGCGTTGGAACCCAAGCGTCGGCAACCGC
TGCGAGAATCTCCGTTCTGATCAGTACGCCTGCATCGCTGGCCCGGACGCCCCCGTTCCGCCCTCACCCCCGATC
CCGGTGCCGACCCCGAGGCCTATCCAGCCCGGCATGATCGACGGCTGTCGCCGCTTCCATTTCGTCGTTCGAGGC
GAGACGTGTATCACCGTCGGGGACGTCTATGGCGTTTCCTTCGCCGATTTGCTCAAATGGAACCCGGCTATTGGG
CCCGAGTGCGCCAATATGTGGGCGGATACCTTCTTGTGCGTCGGACTTTGATATTTTGCTTCTTTTTGGCTCCCT
GTTTATATGTTTATGCAATTCCGGGTGCAGGTGTGTGGGCACGGCGAGCAGTCAGTCAGCTGAAGACTCTCATGA
CAATCTTCCCAAGTGCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail