Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3948
Gene name
Locationscaffold_308:20868..21490
Strand+
Gene length (bp)622
Transcript length (bp)552
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 5.3E-08 43 83
PF01476 LysM LysM domain 9.9E-02 122 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 166 9.0E-36
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 164 8.0E-35
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 24 164 2.0E-32
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 51 164 2.0E-16
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 1 164 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 166 9.0E-36
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 23 164 8.0E-35
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 24 164 2.0E-32
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 51 164 2.0E-16
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 1 164 2.0E-15
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 49 165 8.0E-12
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 116 165 1.0E-08
sp|D4B4Q2|LYSM4_ARTBC LysM domain-containing protein ARB_03442 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03442 PE=3 SV=2 97 168 4.0E-07
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 107 168 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1111 0.0556 0.9509 0.0338 0.0388 0.0148 0.1056 0.2017 0.1535 0.0029

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999708

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup265
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2459
Ophiocordyceps australis map64 (Brazil) OphauB2|4462
Ophiocordyceps australis map64 (Brazil) OphauB2|7698
Ophiocordyceps camponoti-floridani Ophcf2|02949
Ophiocordyceps camponoti-rufipedis Ophun1|7477
Ophiocordyceps kimflemingae Ophio5|3948 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1076
Ophiocordyceps subramaniannii Hirsu2|3841
Ophiocordyceps subramaniannii Hirsu2|6024
Ophiocordyceps subramaniannii Hirsu2|8728
Ophiocordyceps subramaniannii Hirsu2|9191

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3948
MHLHALALTLLCSLSSVGVAALSSIETPRPSLPDMIQGCHAFYYVRKGDTCGSIAAKNFISISQIRRWNPSVGNR
CENLRSDQYACIAGPDAPVPPSPPIPVPTPRPIQPGMIDGCRRFHFVVRGETCITVGDVYGVSFADLLKWNPAIG
PECANMWADTFLCVGTASSQSAEDSHDNLPKCD
Coding >Ophio5|3948
ATGCATCTCCACGCCCTTGCCCTAACGCTGCTCTGCAGCCTCAGCAGCGTCGGCGTCGCCGCCTTGTCCTCCATC
GAAACTCCCCGGCCTTCACTCCCGGACATGATCCAAGGCTGCCACGCCTTCTACTATGTCAGGAAAGGAGATACG
TGCGGGTCCATCGCGGCGAAAAACTTCATCTCCATCAGCCAAATTCGGCGTTGGAACCCAAGCGTCGGCAACCGC
TGCGAGAATCTCCGTTCTGATCAGTACGCCTGCATCGCTGGCCCGGACGCCCCCGTTCCGCCCTCACCCCCGATC
CCGGTGCCGACCCCGAGGCCTATCCAGCCCGGCATGATCGACGGCTGTCGCCGCTTCCATTTCGTCGTTCGAGGC
GAGACGTGTATCACCGTCGGGGACGTCTATGGCGTTTCCTTCGCCGATTTGCTCAAATGGAACCCGGCTATTGGG
CCCGAGTGCGCCAATATGTGGGCGGATACCTTCTTGTGTGTGGGCACGGCGAGCAGTCAGTCAGCTGAAGACTCT
CATGACAATCTTCCCAAGTGCGAC
Transcript >Ophio5|3948
ATGCATCTCCACGCCCTTGCCCTAACGCTGCTCTGCAGCCTCAGCAGCGTCGGCGTCGCCGCCTTGTCCTCCATC
GAAACTCCCCGGCCTTCACTCCCGGACATGATCCAAGGCTGCCACGCCTTCTACTATGTCAGGAAAGGAGATACG
TGCGGGTCCATCGCGGCGAAAAACTTCATCTCCATCAGCCAAATTCGGCGTTGGAACCCAAGCGTCGGCAACCGC
TGCGAGAATCTCCGTTCTGATCAGTACGCCTGCATCGCTGGCCCGGACGCCCCCGTTCCGCCCTCACCCCCGATC
CCGGTGCCGACCCCGAGGCCTATCCAGCCCGGCATGATCGACGGCTGTCGCCGCTTCCATTTCGTCGTTCGAGGC
GAGACGTGTATCACCGTCGGGGACGTCTATGGCGTTTCCTTCGCCGATTTGCTCAAATGGAACCCGGCTATTGGG
CCCGAGTGCGCCAATATGTGGGCGGATACCTTCTTGTGTGTGGGCACGGCGAGCAGTCAGTCAGCTGAAGACTCT
CATGACAATCTTCCCAAGTGCGACTGA
Gene >Ophio5|3948
ATGCATCTCCACGCCCTTGCCCTAACGCTGCTCTGCAGCCTCAGCAGCGTCGGCGTCGCCGCCTTGTCCTCCATC
GAAACTCCCCGGCCTTCACTCCCGGACATGATCCAAGGCTGCCACGCCTTCTACTATGTCAGGAAAGGAGATACG
TGCGGGTCCATCGCGGCGAAAAACTTCATCTCCATCAGCCAAATTCGGCGTTGGAACCCAAGCGTCGGCAACCGC
TGCGAGAATCTCCGTTCTGATCAGTACGCCTGCATCGCTGGCCCGGACGCCCCCGTTCCGCCCTCACCCCCGATC
CCGGTGCCGACCCCGAGGCCTATCCAGCCCGGCATGATCGACGGCTGTCGCCGCTTCCATTTCGTCGTTCGAGGC
GAGACGTGTATCACCGTCGGGGACGTCTATGGCGTTTCCTTCGCCGATTTGCTCAAATGGAACCCGGCTATTGGG
CCCGAGTGCGCCAATATGTGGGCGGATACCTTCTTGTGCGTCGGACTTTGATATTTTGCTTCTTTTTGGCTCCCT
GTTTATATGTTTATGCAATTCCGGGTGCAGGTGTGTGGGCACGGCGAGCAGTCAGTCAGCTGAAGACTCTCATGA
CAATCTTCCCAAGTGCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail