Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3946
Gene name
Locationscaffold_308:16615..18043
Strand+
Gene length (bp)1428
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.6E-30 324 431
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 4.0E-30 216 314
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 8.3E-22 5 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0CQN7|NCB5R_LACBS NADH-cytochrome b5 reductase 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MCR1.1 PE=3 SV=1 208 455 2.0E-74
sp|Q9UR35|NCB5R_MORAP NADH-cytochrome b5 reductase 1 OS=Mortierella alpina GN=CBR1 PE=2 SV=1 208 455 3.0E-71
sp|Q0CY37|NCB5R_ASPTN NADH-cytochrome b5 reductase 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbr1 PE=3 SV=1 208 455 2.0E-69
sp|A1C7E9|NCB5R_ASPCL NADH-cytochrome b5 reductase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbr1 PE=3 SV=1 208 455 5.0E-69
sp|A7TNL7|NCB5R_VANPO NADH-cytochrome b5 reductase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CBR1 PE=3 SV=1 212 455 1.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0CQN7|NCB5R_LACBS NADH-cytochrome b5 reductase 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MCR1.1 PE=3 SV=1 208 455 2.0E-74
sp|Q9UR35|NCB5R_MORAP NADH-cytochrome b5 reductase 1 OS=Mortierella alpina GN=CBR1 PE=2 SV=1 208 455 3.0E-71
sp|Q0CY37|NCB5R_ASPTN NADH-cytochrome b5 reductase 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbr1 PE=3 SV=1 208 455 2.0E-69
sp|A1C7E9|NCB5R_ASPCL NADH-cytochrome b5 reductase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbr1 PE=3 SV=1 208 455 5.0E-69
sp|A7TNL7|NCB5R_VANPO NADH-cytochrome b5 reductase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CBR1 PE=3 SV=1 212 455 1.0E-68
sp|Q6CID0|NCB5R_KLULA NADH-cytochrome b5 reductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBR1 PE=3 SV=1 208 455 2.0E-68
sp|Q2UFN3|NCB5R_ASPOR NADH-cytochrome b5 reductase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cbr1 PE=3 SV=2 208 455 6.0E-68
sp|A2QCV4|NCB5R_ASPNC NADH-cytochrome b5 reductase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbr1 PE=3 SV=1 208 455 1.0E-67
sp|A6R2K7|NCB5R_AJECN NADH-cytochrome b5 reductase 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CBR1 PE=3 SV=1 204 455 1.0E-67
sp|Q54NC1|NCB5R_DICDI NADH-cytochrome b5 reductase 1 OS=Dictyostelium discoideum GN=cyb5r1 PE=3 SV=1 208 439 1.0E-67
sp|O74557|NCB5R_SCHPO NADH-cytochrome b5 reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbr1 PE=3 SV=1 218 455 6.0E-67
sp|Q4X0B5|NCB5R_ASPFU NADH-cytochrome b5 reductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbr1 PE=3 SV=2 208 455 6.0E-67
sp|Q1DWN4|NCB5R_COCIM NADH-cytochrome b5 reductase 1 OS=Coccidioides immitis (strain RS) GN=CBR1 PE=3 SV=1 208 455 7.0E-67
sp|A1DHW1|NCB5R_NEOFI NADH-cytochrome b5 reductase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbr1 PE=3 SV=2 208 455 8.0E-67
sp|Q5AZB4|NCB5R_EMENI NADH-cytochrome b5 reductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbr1 PE=3 SV=2 208 455 1.0E-66
sp|Q6BUX2|NCB5R_DEBHA NADH-cytochrome b5 reductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBR1 PE=3 SV=1 208 455 3.0E-66
sp|Q5BJ68|NB5R2_XENTR NADH-cytochrome b5 reductase 2 OS=Xenopus tropicalis GN=cyb5r2 PE=2 SV=1 208 443 1.0E-65
sp|A3GF86|NCB5R_PICST NADH-cytochrome b5 reductase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CBR1 PE=3 SV=2 208 455 1.0E-65
sp|Q4PGW7|NCB5R_USTMA NADH-cytochrome b5 reductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CBR1 PE=3 SV=1 208 455 1.0E-65
sp|Q5PQA4|NB5R2_XENLA NADH-cytochrome b5 reductase 2 OS=Xenopus laevis GN=cyb5r2 PE=2 SV=1 208 443 2.0E-65
sp|A5DQ25|NCB5R_PICGU NADH-cytochrome b5 reductase 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CBR1 PE=3 SV=1 208 455 3.0E-64
sp|Q6BCY4|NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens GN=CYB5R2 PE=1 SV=1 209 439 3.0E-64
sp|A4R935|NCB5R_MAGO7 NADH-cytochrome b5 reductase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CBR1 PE=3 SV=1 208 455 6.0E-64
sp|Q0UEY4|NCB5R_PHANO NADH-cytochrome b5 reductase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CBR1 PE=3 SV=2 208 455 6.0E-64
sp|Q59P03|NCB5R_CANAL NADH-cytochrome b5 reductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBR1 PE=3 SV=1 208 455 3.0E-63
sp|Q3KNK3|NB5R2_MOUSE NADH-cytochrome b5 reductase 2 OS=Mus musculus GN=Cyb5r2 PE=2 SV=2 209 455 3.0E-63
sp|A6ZVM6|NCB5R_YEAS7 NADH-cytochrome b5 reductase 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CBR1 PE=3 SV=2 208 455 7.0E-63
sp|Q5ZHX7|NB5R2_CHICK NADH-cytochrome b5 reductase 2 OS=Gallus gallus GN=CYB5R2 PE=2 SV=1 209 440 1.0E-62
sp|A5E7U2|NCB5R_LODEL NADH-cytochrome b5 reductase 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CBR1 PE=3 SV=1 208 455 2.0E-62
sp|P38626|NCB5R_YEAST NADH-cytochrome b5 reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBR1 PE=1 SV=2 208 455 2.0E-62
sp|Q7RXL1|NCB5R_NEUCR NADH-cytochrome b5 reductase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbr1 PE=3 SV=1 202 455 3.0E-62
sp|P0CP14|NCB5R_CRYNJ NADH-cytochrome b5 reductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CBR1 PE=3 SV=1 208 455 9.0E-62
sp|P0CP15|NCB5R_CRYNB NADH-cytochrome b5 reductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CBR1 PE=3 SV=1 208 455 9.0E-62
sp|Q9ZNT1|NB5R1_ARATH NADH--cytochrome b5 reductase 1 OS=Arabidopsis thaliana GN=CBR1 PE=1 SV=1 208 439 4.0E-61
sp|Q6AY12|NB5R2_RAT NADH-cytochrome b5 reductase 2 OS=Rattus norvegicus GN=Cyb5r2 PE=2 SV=1 209 439 5.0E-61
sp|Q6CA86|NCB5R_YARLI NADH-cytochrome b5 reductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBR1 PE=3 SV=1 213 455 6.0E-61
sp|Q6FLT3|NCB5R_CANGA NADH-cytochrome b5 reductase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBR1 PE=3 SV=1 212 455 4.0E-60
sp|Q75AL4|NCB5R_ASHGO NADH-cytochrome b5 reductase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBR1 PE=3 SV=1 212 455 4.0E-60
sp|Q0P487|NB5R2_DANRE NADH-cytochrome b5 reductase 2 OS=Danio rerio GN=cyb5r2 PE=2 SV=2 209 439 5.0E-60
sp|Q9UHQ9|NB5R1_HUMAN NADH-cytochrome b5 reductase 1 OS=Homo sapiens GN=CYB5R1 PE=1 SV=1 204 439 6.0E-60
sp|Q3MHW9|NB5R1_BOVIN NADH-cytochrome b5 reductase 1 OS=Bos taurus GN=CYB5R1 PE=2 SV=1 208 439 1.0E-59
sp|Q9DB73|NB5R1_MOUSE NADH-cytochrome b5 reductase 1 OS=Mus musculus GN=Cyb5r1 PE=1 SV=1 209 439 6.0E-59
sp|Q5EB81|NB5R1_RAT NADH-cytochrome b5 reductase 1 OS=Rattus norvegicus GN=Cyb5r1 PE=2 SV=1 209 439 8.0E-58
sp|P00387|NB5R3_HUMAN NADH-cytochrome b5 reductase 3 OS=Homo sapiens GN=CYB5R3 PE=1 SV=3 216 455 1.0E-57
sp|Q9DCN2|NB5R3_MOUSE NADH-cytochrome b5 reductase 3 OS=Mus musculus GN=Cyb5r3 PE=1 SV=3 216 440 2.0E-57
sp|P07514|NB5R3_BOVIN NADH-cytochrome b5 reductase 3 OS=Bos taurus GN=CYB5R3 PE=1 SV=3 216 440 1.0E-56
sp|P83686|NB5R3_PIG NADH-cytochrome b5 reductase 3 (Fragment) OS=Sus scrofa GN=CYB5R3 PE=1 SV=1 216 440 1.0E-56
sp|Q60HG4|NB5R3_MACFA NADH-cytochrome b5 reductase 3 OS=Macaca fascicularis GN=CYB5R3 PE=2 SV=3 211 440 2.0E-56
sp|P20070|NB5R3_RAT NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus GN=Cyb5r3 PE=1 SV=2 216 440 3.0E-56
sp|Q0X0E5|NB5R3_CANLF NADH-cytochrome b5 reductase 3 OS=Canis lupus familiaris GN=CYB5R3 PE=1 SV=1 216 440 7.0E-56
sp|Q12746|PGA3_YEAST Plasma membrane-associated coenzyme Q6 reductase PGA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGA3 PE=1 SV=1 208 455 9.0E-54
sp|Q1DXN1|MCR1_COCIM NADH-cytochrome b5 reductase 2 OS=Coccidioides immitis (strain RS) GN=MCR1 PE=3 SV=2 205 430 5.0E-49
sp|A7THS1|MCR1A_VANPO NADH-cytochrome b5 reductase 2-A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MCR1A PE=3 SV=1 212 455 1.0E-48
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 208 441 6.0E-48
sp|Q04516|AIM33_YEAST Uncharacterized oxidoreductase AIM33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM33 PE=1 SV=1 216 455 1.0E-47
sp|A1D4H0|MCR1_NEOFI NADH-cytochrome b5 reductase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mcr1 PE=3 SV=1 183 455 1.0E-47
sp|Q2UKB8|MCR1_ASPOR NADH-cytochrome b5 reductase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mcr1 PE=3 SV=1 205 430 3.0E-47
sp|A1CRK9|MCR1_ASPCL NADH-cytochrome b5 reductase 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mcr1 PE=3 SV=1 204 430 2.0E-46
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 218 439 3.0E-46
sp|A5DQE4|MCR1_PICGU NADH-cytochrome b5 reductase 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MCR1 PE=3 SV=2 207 451 1.0E-45
sp|Q75C62|MCR1_ASHGO NADH-cytochrome b5 reductase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCR1 PE=3 SV=1 212 429 2.0E-45
sp|A2Q898|MCR1_ASPNC NADH-cytochrome b5 reductase 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mcr1 PE=3 SV=1 205 455 2.0E-45
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 218 427 2.0E-45
sp|P83291|NB5R2_ARATH NADH-cytochrome b5 reductase-like protein OS=Arabidopsis thaliana GN=CBR2 PE=1 SV=2 126 427 2.0E-45
sp|Q7SFY2|MCR1_NEUCR NADH-cytochrome b5 reductase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcr-1 PE=3 SV=1 206 455 2.0E-45
sp|Q5BG98|MCR1_EMENI NADH-cytochrome b5 reductase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcr1 PE=3 SV=1 205 429 3.0E-45
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 218 428 4.0E-45
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 221 455 5.0E-45
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 218 427 4.0E-44
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 193 455 7.0E-44
sp|A7EKT5|MCR1_SCLS1 NADH-cytochrome b5 reductase 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mcr1 PE=3 SV=1 213 430 8.0E-44
sp|A6SI59|MCR1_BOTFB NADH-cytochrome b5 reductase 2 OS=Botryotinia fuckeliana (strain B05.10) GN=mcr1 PE=3 SV=1 213 430 8.0E-44
sp|Q6C9G8|MCR1_YARLI NADH-cytochrome b5 reductase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCR1 PE=3 SV=1 213 455 1.0E-43
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 218 455 1.0E-43
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 218 427 2.0E-43
sp|Q4WJW8|MCR1_ASPFU NADH-cytochrome b5 reductase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mcr1 PE=3 SV=1 205 455 2.0E-43
sp|Q0CRD8|MCR1_ASPTN NADH-cytochrome b5 reductase 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mcr1 PE=3 SV=2 205 430 2.0E-43
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 193 428 7.0E-43
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 221 455 1.0E-42
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 208 430 2.0E-42
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 218 439 3.0E-42
sp|Q6BQ54|MCR1_DEBHA NADH-cytochrome b5 reductase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCR1 PE=3 SV=1 207 429 4.0E-42
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 218 429 1.0E-41
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 218 427 2.0E-41
sp|Q6CS27|MCR1_KLULA NADH-cytochrome b5 reductase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCR1 PE=3 SV=1 147 429 2.0E-41
sp|A4QR21|MCR1_MAGO7 NADH-cytochrome b5 reductase 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MCR1 PE=3 SV=1 213 430 2.0E-41
sp|A6ZZH2|MCR1_YEAS7 NADH-cytochrome b5 reductase 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=MCR1 PE=3 SV=1 207 455 3.0E-41
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 218 441 4.0E-41
sp|A6R1T7|MCR1_AJECN NADH-cytochrome b5 reductase 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MCR1 PE=3 SV=1 123 429 5.0E-41
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 218 441 7.0E-41
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 191 439 9.0E-41
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 218 441 1.0E-40
sp|P36060|MCR1_YEAST NADH-cytochrome b5 reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCR1 PE=1 SV=1 207 455 2.0E-40
sp|Q0U9W5|MCR1_PHANO NADH-cytochrome b5 reductase 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MCR1 PE=3 SV=1 213 455 2.0E-40
sp|Q2HG02|MCR1_CHAGB NADH-cytochrome b5 reductase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MCR1 PE=3 SV=1 204 430 4.0E-40
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 218 427 4.0E-40
sp|Q6FUX5|MCR1_CANGA NADH-cytochrome b5 reductase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCR1 PE=3 SV=1 213 430 6.0E-40
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 208 441 1.0E-39
sp|A3LT66|MCR1_PICST NADH-cytochrome b5 reductase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MCR1 PE=3 SV=2 207 430 2.0E-39
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 218 439 2.0E-39
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 208 441 7.0E-39
sp|A5E5C5|MCR1_LODEL NADH-cytochrome b5 reductase 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MCR1 PE=3 SV=1 207 430 2.0E-38
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 218 439 1.0E-37
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 216 439 1.0E-37
sp|P49050|NIA_PICAN Nitrate reductase [NADPH] OS=Pichia angusta GN=YNR1 PE=1 SV=1 208 426 2.0E-36
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 1 439 2.0E-36
sp|Q59M70|MCR1_CANAL NADH-cytochrome b5 reductase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCR1 PE=3 SV=1 209 430 6.0E-36
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 203 454 1.0E-35
sp|Q4P7Y8|MCR1_USTMA NADH-cytochrome b5 reductase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MCR1 PE=3 SV=1 258 455 3.0E-34
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 1 439 4.0E-34
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 1 439 3.0E-33
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 200 439 4.0E-33
sp|P36858|NIA_ASPNG Nitrate reductase [NADPH] OS=Aspergillus niger GN=niaD PE=3 SV=1 204 439 1.0E-32
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 203 441 3.0E-32
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 208 439 2.0E-30
sp|A7TM72|MCR1B_VANPO NADH-cytochrome b5 reductase 2-B OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MCR1B PE=3 SV=1 205 439 2.0E-29
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 208 439 4.0E-29
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 208 439 7.0E-29
sp|P39871|NIA2_MAIZE Nitrate reductase [NAD(P)H] (Fragment) OS=Zea mays GN=NAR PE=2 SV=1 242 441 9.0E-28
sp|P39882|NIA_LOTTE Nitrate reductase [NADH] (Fragment) OS=Lotus tetragonolobus GN=NIA PE=2 SV=1 318 439 4.0E-27
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 213 439 5.0E-26
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 213 439 1.0E-25
sp|B1AS42|NB5R5_MOUSE NADH-cytochrome b5 reductase-like OS=Mus musculus GN=Cyb5rl PE=2 SV=1 208 455 3.0E-23
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 3 123 7.0E-23
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 213 439 2.0E-22
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 3 87 5.0E-18
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 3 81 8.0E-18
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 6 101 8.0E-18
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 3 85 9.0E-18
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 3 75 1.0E-17
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 3 86 1.0E-17
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 7 102 2.0E-17
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 6 101 2.0E-17
sp|Q6IPT4|NB5R5_HUMAN NADH-cytochrome b5 reductase-like OS=Homo sapiens GN=CYB5RL PE=2 SV=3 208 422 4.0E-17
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 3 87 4.0E-17
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 3 75 9.0E-17
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 3 93 1.0E-16
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 3 75 1.0E-16
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 3 82 1.0E-16
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 3 82 2.0E-16
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 8 102 2.0E-16
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 3 75 4.0E-16
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 3 101 4.0E-16
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 3 86 7.0E-16
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 3 86 9.0E-16
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 3 105 1.0E-15
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 3 102 2.0E-15
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 7 103 2.0E-15
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 7 99 5.0E-15
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 3 101 5.0E-15
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 5 129 9.0E-15
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 2 76 1.0E-14
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 3 94 1.0E-14
sp|O85675|ANTDC_ACIAD Anthranilate 1,2-dioxygenase electron transfer component OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=antC PE=1 SV=1 240 434 2.0E-14
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 7 102 4.0E-14
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 7 102 6.0E-14
sp|P22868|MMOC_METCA Methane monooxygenase component C OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mmoC PE=1 SV=2 256 440 9.0E-14
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 3 75 3.0E-13
sp|Q88PP0|HMP_PSEPK Flavohemoprotein OS=Pseudomonas putida (strain KT2440) GN=hmp PE=3 SV=1 198 440 3.0E-13
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 3 97 4.0E-13
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 3 75 6.0E-13
sp|Q8GAZ4|HMP_BURST Flavohemoprotein OS=Burkholderia sp. (strain TH2) GN=hmp PE=3 SV=1 247 440 1.0E-12
sp|P76081|PAAE_ECOLI 1,2-phenylacetyl-CoA epoxidase, subunit E OS=Escherichia coli (strain K12) GN=paaE PE=1 SV=1 211 440 1.0E-12
sp|Q51603|CBDC_BURCE 2-halobenzoate 1,2-dioxygenase electron transfer component OS=Burkholderia cepacia GN=cbdC PE=1 SV=1 225 435 2.0E-12
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 8 68 2.0E-12
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 3 75 5.0E-12
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 3 110 8.0E-12
sp|O52378|NAGAA_RALSP Ferredoxin--NAD(P)(+) reductase (naphthalene dioxygenase/salicylate 5-hydroxylase ferredoxin-specific) OS=Ralstonia sp. GN=nagAa PE=1 SV=1 277 443 9.0E-12
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 3 85 1.0E-11
sp|Q53563|MMOC_METTR Methane monooxygenase component C OS=Methylosinus trichosporium GN=mmoC PE=1 SV=1 201 377 2.0E-11
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 3 75 3.0E-11
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 3 85 4.0E-11
sp|P28901|FENR_SHIFL Ferredoxin--NADP reductase OS=Shigella flexneri GN=fpr PE=3 SV=3 233 434 4.0E-11
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 3 75 5.0E-11
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 3 82 5.0E-11
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 3 75 5.0E-11
sp|Q9UAG7|FHBA_DICDI Flavohemoprotein A OS=Dictyostelium discoideum GN=fhbA PE=2 SV=1 206 448 5.0E-11
sp|P07771|BENC_ACIAD Benzoate 1,2-dioxygenase electron transfer component OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benC PE=1 SV=2 247 439 9.0E-11
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 3 75 1.0E-10
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 3 86 2.0E-10
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 3 75 2.0E-10
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 3 82 2.0E-10
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 3 75 2.0E-10
sp|P23101|XYLZ_PSEPU Toluate 1,2-dioxygenase electron transfer component OS=Pseudomonas putida GN=xylZ PE=3 SV=1 232 439 3.0E-10
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 1 75 4.0E-10
sp|Q9X406|MSMD_METHY Putative methanesulfonate monooxygenase ferredoxin reductase subunit OS=Methylosulfonomonas methylovora GN=msmD PE=1 SV=1 227 434 4.0E-10
sp|Q8ETH0|HMP_OCEIH Flavohemoprotein OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hmp PE=3 SV=1 247 439 4.0E-10
sp|Q5QYQ8|NQRF_IDILO Na(+)-translocating NADH-quinone reductase subunit F OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=nqrF PE=3 SV=1 252 438 5.0E-10
sp|A6V3A2|NQRF_PSEA7 Na(+)-translocating NADH-quinone reductase subunit F OS=Pseudomonas aeruginosa (strain PA7) GN=nqrF PE=3 SV=1 254 438 6.0E-10
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 3 75 7.0E-10
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 2 104 7.0E-10
sp|Q59MV9|FHP_CANAL Flavohemoprotein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YHB1 PE=2 SV=1 247 441 1.0E-09
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 2 107 1.0E-09
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 2 75 2.0E-09
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 3 75 2.0E-09
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 3 75 2.0E-09
sp|P9WJ93|KSHB_MYCTU 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hmp PE=1 SV=1 260 440 2.0E-09
sp|P9WJ92|KSHB_MYCTO 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hmp PE=3 SV=1 260 440 2.0E-09
sp|Q9HZL1|NQRF_PSEAE Na(+)-translocating NADH-quinone reductase subunit F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nqrF PE=3 SV=1 254 438 3.0E-09
sp|Q15YQ1|NQRF_PSEA6 Na(+)-translocating NADH-quinone reductase subunit F OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=nqrF PE=3 SV=1 252 438 4.0E-09
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 5 86 5.0E-09
sp|Q54D73|FHBB_DICDI Flavohemoprotein B OS=Dictyostelium discoideum GN=fhbB PE=1 SV=1 206 439 5.0E-09
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 3 81 6.0E-09
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 2 75 7.0E-09
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 2 75 7.0E-09
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 2 110 7.0E-09
sp|Q02PF8|NQRF_PSEAB Na(+)-translocating NADH-quinone reductase subunit F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nqrF PE=3 SV=1 254 438 9.0E-09
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 2 75 1.0E-08
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 1 75 1.0E-08
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 3 106 1.0E-08
sp|Q73B49|HMP_BACC1 Flavohemoprotein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hmp PE=3 SV=1 204 438 2.0E-08
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 7 55 2.0E-08
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 2 75 3.0E-08
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 2 128 3.0E-08
sp|Q6HLA6|HMP_BACHK Flavohemoprotein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hmp PE=3 SV=1 204 438 6.0E-08
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 5 73 6.0E-08
sp|P40609|HMP_VIBPA Flavohemoprotein OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmp PE=3 SV=2 216 440 6.0E-08
sp|Q81FW4|HMP_BACCR Flavohemoprotein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hmp PE=3 SV=1 204 438 9.0E-08
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 6 126 1.0E-07
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 2 56 1.0E-07
sp|A6VW13|NQRF_MARMS Na(+)-translocating NADH-quinone reductase subunit F OS=Marinomonas sp. (strain MWYL1) GN=nqrF PE=3 SV=1 254 438 1.0E-07
sp|Q81T23|HMP_BACAN Flavohemoprotein OS=Bacillus anthracis GN=hmp PE=3 SV=1 247 438 1.0E-07
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 3 54 1.0E-07
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 3 137 1.0E-07
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 1 54 1.0E-07
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 1 85 2.0E-07
sp|P49852|HMP_BACSU Flavohemoprotein OS=Bacillus subtilis (strain 168) GN=hmp PE=2 SV=1 197 438 2.0E-07
sp|Q03331|FHP_CANNO Flavohemoprotein OS=Candida norvegensis PE=1 SV=3 247 434 2.0E-07
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 92 2.0E-07
sp|A6T526|NQRF_KLEP7 Na(+)-translocating NADH-quinone reductase subunit F OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nqrF PE=3 SV=1 263 438 2.0E-07
sp|Q8DCU2|HMP_VIBVU Flavohemoprotein OS=Vibrio vulnificus (strain CMCP6) GN=hmp PE=3 SV=1 163 440 2.0E-07
sp|Q3C1E0|TPDR1_COMSP Terephthalate 1,2-dioxygenase, reductase component 1 OS=Comamonas sp. GN=tphA1I PE=1 SV=1 208 439 3.0E-07
sp|Q3C1D2|TPDR2_COMSP Terephthalate 1,2-dioxygenase, reductase component 2 OS=Comamonas sp. GN=tphA1II PE=1 SV=1 208 439 3.0E-07
sp|A6VLY1|NQRF_ACTSZ Na(+)-translocating NADH-quinone reductase subunit F OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=nqrF PE=3 SV=1 254 438 3.0E-07
sp|Q8K1P9|FADS3_RAT Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1 3 119 4.0E-07
sp|Q5F6X5|NQRF_NEIG1 Na(+)-translocating NADH-quinone reductase subunit F OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nqrF PE=3 SV=1 259 438 4.0E-07
sp|Q7MH09|HMP_VIBVY Flavohemoprotein OS=Vibrio vulnificus (strain YJ016) GN=hmp PE=3 SV=1 218 440 4.0E-07
sp|Q0I5Y1|NQRF_HAES1 Na(+)-translocating NADH-quinone reductase subunit F OS=Haemophilus somnus (strain 129Pt) GN=nqrF PE=3 SV=1 254 438 4.0E-07
sp|Q9JJE7|FADS3_MOUSE Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2 3 119 5.0E-07
sp|Q9K0M8|NQRF_NEIMB Na(+)-translocating NADH-quinone reductase subunit F OS=Neisseria meningitidis serogroup B (strain MC58) GN=nqrF PE=3 SV=1 254 438 5.0E-07
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 3 124 5.0E-07
sp|Q1Q7Z7|NQRF_PSYCK Na(+)-translocating NADH-quinone reductase subunit F OS=Psychrobacter cryohalolentis (strain K5) GN=nqrF PE=3 SV=1 254 438 5.0E-07
sp|A1KSH3|NQRF_NEIMF Na(+)-translocating NADH-quinone reductase subunit F OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nqrF PE=3 SV=1 254 438 5.0E-07
sp|Q9JVQ3|NQRF_NEIMA Na(+)-translocating NADH-quinone reductase subunit F OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nqrF PE=3 SV=1 254 438 5.0E-07
sp|A9M2A6|NQRF_NEIM0 Na(+)-translocating NADH-quinone reductase subunit F OS=Neisseria meningitidis serogroup C (strain 053442) GN=nqrF PE=3 SV=1 254 438 5.0E-07
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 1 85 6.0E-07
sp|Q4QP19|NQRF_HAEI8 Na(+)-translocating NADH-quinone reductase subunit F OS=Haemophilus influenzae (strain 86-028NP) GN=nqrF PE=3 SV=1 254 438 6.0E-07
sp|Q7VNU4|NQRF_HAEDU Na(+)-translocating NADH-quinone reductase subunit F OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=nqrF PE=3 SV=1 254 438 6.0E-07
sp|Q4FPV2|NQRF_PSYA2 Na(+)-translocating NADH-quinone reductase subunit F OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=nqrF PE=3 SV=1 254 438 7.0E-07
sp|P19734|DMPP_PSEUF Phenol hydroxylase P5 protein OS=Pseudomonas sp. (strain CF600) GN=dmpP PE=1 SV=3 247 434 7.0E-07
sp|A5UAX6|NQRF_HAEIE Na(+)-translocating NADH-quinone reductase subunit F OS=Haemophilus influenzae (strain PittEE) GN=nqrF PE=3 SV=1 254 438 7.0E-07
sp|O05012|NQRF_HAEIN Na(+)-translocating NADH-quinone reductase subunit F OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nqrF PE=3 SV=1 254 438 8.0E-07
sp|Q9CLA6|NQRF_PASMU Na(+)-translocating NADH-quinone reductase subunit F OS=Pasteurella multocida (strain Pm70) GN=nqrF PE=3 SV=1 254 438 8.0E-07
sp|A4IFP3|FADS3_BOVIN Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1 6 122 1.0E-06
sp|A3MYM7|NQRF_ACTP2 Na(+)-translocating NADH-quinone reductase subunit F OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=nqrF PE=3 SV=1 254 438 1.0E-06
sp|Q7WTJ2|DMPP_ACICP Phenol hydroxylase P5 protein OS=Acinetobacter calcoaceticus (strain PHEA-2) GN=mphP PE=1 SV=3 222 434 1.0E-06
sp|Q605A0|NQRF_METCA Na(+)-translocating NADH-quinone reductase subunit F OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nqrF PE=3 SV=1 263 438 1.0E-06
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 4 75 2.0E-06
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 3 131 2.0E-06
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 6 73 2.0E-06
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 3 54 2.0E-06
sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 5 54 3.0E-06
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 7 73 3.0E-06
sp|A5UFX3|NQRF_HAEIG Na(+)-translocating NADH-quinone reductase subunit F OS=Haemophilus influenzae (strain PittGG) GN=nqrF PE=3 SV=1 254 438 4.0E-06
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 5 73 4.0E-06
sp|P36858|NIA_ASPNG Nitrate reductase [NADPH] OS=Aspergillus niger GN=niaD PE=3 SV=1 4 75 7.0E-06
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 3 108 7.0E-06
sp|Q8GI14|CARAD_PSERE Ferredoxin--NAD(P)(+) reductase CarAd OS=Pseudomonas resinovorans GN=carAd PE=1 SV=1 247 440 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 150 169 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3946
MEYDAKQIAEHNKPEDAWLIIHGKVYDLSNYMKDHPGGPEIINETAGLDASEGFDNAGHSEDAFDIMKDLYKGKL
KGFKEKPAKPARVKVNRPQPAKDKEPSRPLAKLVNQGLFVTATTAIYFLAFRTHSVPEPVTDFIRDSSNEPSRHG
FFRGLLLGAGAFAVLDLWIGRRFTKAFMSRPKGFETYPAHIKMAPRIEKDELLQSGWLDPVNYSNLPLKAKKEVA
PNVFRFTFSLPSKDAVLGLPIGQHVAIKAQVDGENVSRSYTPVSNNADKGVLELVIKVYPDGKLTNGLLANLQVG
DEVPFRGPKGAMRYHRGLCNKIGMVAGGTGITPMFQLIRAICEDDRDLTHVSLIYANKSEQDILLRKELDTFARR
YPQNFEVYYLVDNPPPKWKYGSGHVNQELMAKKLPGPKDDSKVLLCGPPGMVNACKKSLGNLGFPLPGVASKITD
QIFLF
Coding >Ophio5|3946
ATGGAGTACGATGCTAAGCAGATTGCCGAGCATAACAAGCCGGAAGATGCGTGGTTGATTATCCACGGCAAAGTC
TATGACTTGTCCAACTATATGAAAGATCATCCCGGAGGTCCCGAGATCATCAATGAGACTGCCGGACTTGATGCT
AGCGAGGGCTTCGACAATGCCGGCCACTCTGAAGATGCTTTCGATATCATGAAGGACTTGTACAAGGGTAAGCTC
AAGGGCTTCAAGGAGAAGCCAGCGAAGCCGGCCCGGGTCAAAGTCAACAGGCCGCAGCCCGCCAAGGATAAGGAG
CCGTCGCGGCCCCTGGCCAAGCTGGTCAATCAAGGCCTCTTCGTCACCGCCACCACAGCCATCTACTTTTTGGCC
TTTCGTACCCATTCTGTGCCGGAGCCGGTGACGGATTTCATTCGTGATTCTTCCAACGAGCCATCCAGACATGGC
TTCTTCAGGGGGCTTCTACTCGGAGCCGGCGCCTTTGCGGTACTGGATCTCTGGATCGGTCGTCGGTTTACAAAG
GCCTTCATGTCCAGGCCAAAGGGCTTTGAGACTTATCCCGCCCACATCAAGATGGCTCCGAGGATCGAAAAGGAC
GAGCTTCTGCAGAGCGGCTGGTTAGACCCGGTCAACTATTCCAACCTCCCCCTCAAGGCAAAGAAGGAGGTTGCC
CCGAATGTCTTTCGCTTCACCTTCAGCCTTCCTTCCAAAGACGCCGTGCTCGGTCTGCCGATTGGCCAGCACGTT
GCCATCAAGGCCCAGGTCGACGGCGAGAACGTGTCCCGGTCGTACACGCCCGTGTCCAACAACGCCGACAAGGGC
GTCCTCGAGCTGGTCATCAAGGTGTATCCGGATGGCAAGTTGACCAACGGACTGCTTGCCAACCTCCAGGTCGGC
GACGAGGTTCCCTTCAGAGGCCCCAAGGGCGCAATGCGGTATCACCGCGGCCTCTGCAACAAGATTGGCATGGTC
GCCGGCGGTACCGGCATCACGCCCATGTTCCAGCTCATTCGTGCCATTTGCGAAGACGACCGCGACCTGACCCAC
GTCAGCCTCATCTACGCCAACAAGTCGGAGCAAGACATCCTCCTTCGGAAAGAGCTCGACACGTTTGCCAGGCGA
TACCCGCAGAATTTCGAGGTTTACTACCTCGTTGATAACCCACCACCCAAATGGAAGTATGGCAGCGGCCATGTA
AACCAGGAACTCATGGCGAAGAAGCTTCCTGGGCCCAAGGACGACTCCAAGGTTCTCTTGTGCGGCCCGCCCGGC
ATGGTCAACGCGTGTAAGAAATCGCTCGGTAATCTTGGGTTTCCTCTGCCGGGAGTGGCATCCAAGATCACAGAC
CAGATCTTCCTATTT
Transcript >Ophio5|3946
ATGGAGTACGATGCTAAGCAGATTGCCGAGCATAACAAGCCGGAAGATGCGTGGTTGATTATCCACGGCAAAGTC
TATGACTTGTCCAACTATATGAAAGATCATCCCGGAGGTCCCGAGATCATCAATGAGACTGCCGGACTTGATGCT
AGCGAGGGCTTCGACAATGCCGGCCACTCTGAAGATGCTTTCGATATCATGAAGGACTTGTACAAGGGTAAGCTC
AAGGGCTTCAAGGAGAAGCCAGCGAAGCCGGCCCGGGTCAAAGTCAACAGGCCGCAGCCCGCCAAGGATAAGGAG
CCGTCGCGGCCCCTGGCCAAGCTGGTCAATCAAGGCCTCTTCGTCACCGCCACCACAGCCATCTACTTTTTGGCC
TTTCGTACCCATTCTGTGCCGGAGCCGGTGACGGATTTCATTCGTGATTCTTCCAACGAGCCATCCAGACATGGC
TTCTTCAGGGGGCTTCTACTCGGAGCCGGCGCCTTTGCGGTACTGGATCTCTGGATCGGTCGTCGGTTTACAAAG
GCCTTCATGTCCAGGCCAAAGGGCTTTGAGACTTATCCCGCCCACATCAAGATGGCTCCGAGGATCGAAAAGGAC
GAGCTTCTGCAGAGCGGCTGGTTAGACCCGGTCAACTATTCCAACCTCCCCCTCAAGGCAAAGAAGGAGGTTGCC
CCGAATGTCTTTCGCTTCACCTTCAGCCTTCCTTCCAAAGACGCCGTGCTCGGTCTGCCGATTGGCCAGCACGTT
GCCATCAAGGCCCAGGTCGACGGCGAGAACGTGTCCCGGTCGTACACGCCCGTGTCCAACAACGCCGACAAGGGC
GTCCTCGAGCTGGTCATCAAGGTGTATCCGGATGGCAAGTTGACCAACGGACTGCTTGCCAACCTCCAGGTCGGC
GACGAGGTTCCCTTCAGAGGCCCCAAGGGCGCAATGCGGTATCACCGCGGCCTCTGCAACAAGATTGGCATGGTC
GCCGGCGGTACCGGCATCACGCCCATGTTCCAGCTCATTCGTGCCATTTGCGAAGACGACCGCGACCTGACCCAC
GTCAGCCTCATCTACGCCAACAAGTCGGAGCAAGACATCCTCCTTCGGAAAGAGCTCGACACGTTTGCCAGGCGA
TACCCGCAGAATTTCGAGGTTTACTACCTCGTTGATAACCCACCACCCAAATGGAAGTATGGCAGCGGCCATGTA
AACCAGGAACTCATGGCGAAGAAGCTTCCTGGGCCCAAGGACGACTCCAAGGTTCTCTTGTGCGGCCCGCCCGGC
ATGGTCAACGCGTGTAAGAAATCGCTCGGTAATCTTGGGTTTCCTCTGCCGGGAGTGGCATCCAAGATCACAGAC
CAGATCTTCCTATTTTAA
Gene >Ophio5|3946
ATGGAGTACGATGCTAAGCAGATTGCCGAGCATAACAAGCCGGAAGATGCGTGGTTGATTATCCACGGCAAAGGT
AGGCAAGACAAGCCAGCTATGCTTCCTGCTGCCGTGTGATATTGATGAAACCTTGCAGTCTATGACTTGTCCAAC
TATATGAAAGATCATCCCGGAGGTCCCGAGATCATCAATGAGACTGCCGGACTTGATGCTAGCGAGGGCTTCGAC
AATGCCGGCCACTCTGAAGATGCTTTCGATATCATGAAGGACTTGTACAAGGGTAAGCTCAAGGGCTTCAAGGAG
AAGCCAGCGAAGCCGGCCCGGGTCAAAGTCAACAGGCCGCAGCCCGCCAAGGATAAGGAGCCGTCGCGGCCCCTG
GCCAAGCTGGTCAATCAAGGCCTCTTCGTCACCGCCACCACAGCCATCTACTTTTTGGCCTTTCGTACCCATTCT
GTGCCGGAGCCGGTGACGGATTTCATTCGTGATTCTTCCAACGAGCCATCCAGACATGGCTTCTTCAGGGGGCTT
CTACTCGGAGCCGGCGCCTTTGCGGTACTGGATCTCTGGATCGGTCGTCGGTTTACAAAGGCCTTCATGTCCAGG
CCAAAGGGCTTTGAGACTTATCCCGCCCACATCAAGATGGCTCCGAGGATCGAAAAGGACGAGCTTCTGCAGAGC
GGCTGGTTAGACCCGGTCAACTATTCCAACCTCCCCCTCAAGGCAAAGAAGGAGGTTGCCCCGAATGTCTTTCGC
TTCACCTTCAGCCTTCCTTCCAAAGACGCCGTGCTCGGTCTGCCGATTGGCCAGCACGTTGCCATCAAGGCCCAG
GTCGACGGCGAGAACGTGTCCCGGTCGTACACGCCCGTGTCCAACAACGCCGACAAGGGCGTCCTCGAGCTGGTC
ATCAAGGTGTATCCGGATGGCAAGTTGACCAACGGACTGCTTGCCAACCTCCAGGTCGGCGACGAGGTTCCCTTC
AGAGGCCCCAAGGGCGCAATGCGGTATCACCGCGGCCTCTGCAACAAGATTGGCATGGTCGCCGGCGGTACCGGC
ATCACGCCCATGTTCCAGCTCATTCGTGCCATTTGCGAAGACGACCGCGACCTGACCCACGTCAGCCTCATCTAC
GCCAACAAGTCGGAGCAAGACATCCTCCTTCGGAAAGAGCTCGACACGTTTGCCAGGCGATACCCGCAGAATTTC
GAGGTTTACTACCTCGTTGATAACCCACCACCCAAATGGAAGTATGGCAGCGGCCATGTAAACCAGGAACTCATG
GCGAAGAAGCTTCCTGGGCCCAAGGACGACTCCAAGGTTCTCTTGTGCGGCCCGCCCGGCATGGTCAACGCGTGT
AAGAAATCGCTCGGTAATCTTGGGTTTCCTCTGCCGGGAGTGGCATCCAAGATCACAGACCAGATCTTCCTATTT
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail