Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3937
Gene name
Locationscaffold_307:21743..22790
Strand-
Gene length (bp)1047
Transcript length (bp)1047
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 2.0E-07 132 165

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 9.40 3.12 15.67
CcL In ants, during behavior modification 1.33 0.00 3.16
CcD In ants, recently dead 1.59 0.00 3.18

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.003754 yes
SC16a CcD 0.000286 yes
CcL CcD 0.808320 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3937
MMHRSSSVTLIIAALFVILLTWPYHRLSWEAIRTRAVSLRPNKGIPNTVHFIFLLKEPDDDFPFAFSHYLSVYSA
WYYLQPSTIYLHTDAGHGQIHRARQGLAGKWAQLIMEMPGLIINRVKAPAQTNHGVEIVEMAHKSDFIRVHVLHK
LGGVYMDFDVFFIHDARPLLTTGFESVSGREPAGLMTAGIFFSRKRSTLLNLWMERMHQVFDGGWTTHSNGLMTR
IGEQLIQQNRKLLVLDESAFTPVTWESQGIKELLEVHDDVPSMLEHHSPGDKLALLNHYDEPLPSWAINFNKSYS
IHAFHIEEEGGNPVTPRKVLQRQSNIGRALYPIVRNMYHRGLVSLDDE
Coding >Ophio5|3937
ATGATGCACCGGTCTTCTTCGGTGACTCTGATCATCGCTGCTCTCTTTGTCATTCTCTTGACATGGCCCTATCAC
CGACTCAGCTGGGAGGCTATCAGGACCAGAGCGGTCTCCTTACGGCCTAACAAGGGGATTCCGAATACCGTTCAT
TTCATCTTTCTGCTGAAAGAGCCTGACGACGACTTTCCCTTTGCCTTTTCCCACTATCTTTCCGTCTATTCCGCC
TGGTATTATCTGCAGCCGAGCACCATCTATCTTCACACCGACGCTGGTCATGGGCAGATTCATCGGGCGCGACAA
GGCCTGGCTGGAAAATGGGCACAGCTCATCATGGAGATGCCCGGCTTGATCATAAACCGTGTCAAAGCCCCTGCA
CAAACGAATCACGGTGTCGAGATCGTCGAGATGGCGCACAAATCTGATTTTATTCGCGTTCATGTCCTTCATAAA
CTCGGGGGGGTTTACATGGACTTTGACGTCTTCTTCATCCACGATGCTCGACCCCTACTCACGACCGGATTCGAA
TCCGTCAGCGGACGAGAACCGGCCGGCTTGATGACGGCCGGCATATTCTTCTCTCGGAAACGAAGCACGCTGTTG
AATCTCTGGATGGAGCGAATGCATCAAGTCTTCGATGGGGGATGGACTACCCATTCCAACGGTCTGATGACGCGA
ATTGGTGAGCAGCTCATCCAGCAAAATCGAAAGCTGCTTGTCTTGGACGAGTCCGCCTTTACACCCGTCACTTGG
GAATCGCAGGGTATCAAGGAGCTCCTCGAGGTGCACGACGACGTGCCGTCCATGCTTGAACATCACAGCCCGGGA
GATAAGCTGGCTTTGCTGAACCACTACGACGAGCCTCTTCCGTCATGGGCCATCAACTTCAACAAGTCGTACAGC
ATACATGCCTTTCACATTGAAGAGGAGGGTGGGAATCCAGTCACGCCACGCAAAGTGCTGCAGCGACAAAGCAAC
ATCGGCCGAGCATTATACCCCATCGTCAGGAACATGTACCACCGAGGCCTCGTTTCGCTCGACGATGAA
Transcript >Ophio5|3937
ATGATGCACCGGTCTTCTTCGGTGACTCTGATCATCGCTGCTCTCTTTGTCATTCTCTTGACATGGCCCTATCAC
CGACTCAGCTGGGAGGCTATCAGGACCAGAGCGGTCTCCTTACGGCCTAACAAGGGGATTCCGAATACCGTTCAT
TTCATCTTTCTGCTGAAAGAGCCTGACGACGACTTTCCCTTTGCCTTTTCCCACTATCTTTCCGTCTATTCCGCC
TGGTATTATCTGCAGCCGAGCACCATCTATCTTCACACCGACGCTGGTCATGGGCAGATTCATCGGGCGCGACAA
GGCCTGGCTGGAAAATGGGCACAGCTCATCATGGAGATGCCCGGCTTGATCATAAACCGTGTCAAAGCCCCTGCA
CAAACGAATCACGGTGTCGAGATCGTCGAGATGGCGCACAAATCTGATTTTATTCGCGTTCATGTCCTTCATAAA
CTCGGGGGGGTTTACATGGACTTTGACGTCTTCTTCATCCACGATGCTCGACCCCTACTCACGACCGGATTCGAA
TCCGTCAGCGGACGAGAACCGGCCGGCTTGATGACGGCCGGCATATTCTTCTCTCGGAAACGAAGCACGCTGTTG
AATCTCTGGATGGAGCGAATGCATCAAGTCTTCGATGGGGGATGGACTACCCATTCCAACGGTCTGATGACGCGA
ATTGGTGAGCAGCTCATCCAGCAAAATCGAAAGCTGCTTGTCTTGGACGAGTCCGCCTTTACACCCGTCACTTGG
GAATCGCAGGGTATCAAGGAGCTCCTCGAGGTGCACGACGACGTGCCGTCCATGCTTGAACATCACAGCCCGGGA
GATAAGCTGGCTTTGCTGAACCACTACGACGAGCCTCTTCCGTCATGGGCCATCAACTTCAACAAGTCGTACAGC
ATACATGCCTTTCACATTGAAGAGGAGGGTGGGAATCCAGTCACGCCACGCAAAGTGCTGCAGCGACAAAGCAAC
ATCGGCCGAGCATTATACCCCATCGTCAGGAACATGTACCACCGAGGCCTCGTTTCGCTCGACGATGAATGA
Gene >Ophio5|3937
ATGATGCACCGGTCTTCTTCGGTGACTCTGATCATCGCTGCTCTCTTTGTCATTCTCTTGACATGGCCCTATCAC
CGACTCAGCTGGGAGGCTATCAGGACCAGAGCGGTCTCCTTACGGCCTAACAAGGGGATTCCGAATACCGTTCAT
TTCATCTTTCTGCTGAAAGAGCCTGACGACGACTTTCCCTTTGCCTTTTCCCACTATCTTTCCGTCTATTCCGCC
TGGTATTATCTGCAGCCGAGCACCATCTATCTTCACACCGACGCTGGTCATGGGCAGATTCATCGGGCGCGACAA
GGCCTGGCTGGAAAATGGGCACAGCTCATCATGGAGATGCCCGGCTTGATCATAAACCGTGTCAAAGCCCCTGCA
CAAACGAATCACGGTGTCGAGATCGTCGAGATGGCGCACAAATCTGATTTTATTCGCGTTCATGTCCTTCATAAA
CTCGGGGGGGTTTACATGGACTTTGACGTCTTCTTCATCCACGATGCTCGACCCCTACTCACGACCGGATTCGAA
TCCGTCAGCGGACGAGAACCGGCCGGCTTGATGACGGCCGGCATATTCTTCTCTCGGAAACGAAGCACGCTGTTG
AATCTCTGGATGGAGCGAATGCATCAAGTCTTCGATGGGGGATGGACTACCCATTCCAACGGTCTGATGACGCGA
ATTGGTGAGCAGCTCATCCAGCAAAATCGAAAGCTGCTTGTCTTGGACGAGTCCGCCTTTACACCCGTCACTTGG
GAATCGCAGGGTATCAAGGAGCTCCTCGAGGTGCACGACGACGTGCCGTCCATGCTTGAACATCACAGCCCGGGA
GATAAGCTGGCTTTGCTGAACCACTACGACGAGCCTCTTCCGTCATGGGCCATCAACTTCAACAAGTCGTACAGC
ATACATGCCTTTCACATTGAAGAGGAGGGTGGGAATCCAGTCACGCCACGCAAAGTGCTGCAGCGACAAAGCAAC
ATCGGCCGAGCATTATACCCCATCGTCAGGAACATGTACCACCGAGGCCTCGTTTCGCTCGACGATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail