Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3931
Gene name
Locationscaffold_307:7979..10031
Strand-
Gene length (bp)2052
Transcript length (bp)1944
Coding sequence length (bp)1941
Protein length (aa) 647

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00319 SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain) 1.9E-22 11 57

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12224|RLM1_YEAST Transcription factor RLM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLM1 PE=1 SV=1 1 84 3.0E-27
sp|P38128|SMP1_YEAST Transcription factor SMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMP1 PE=1 SV=1 1 70 1.0E-26
sp|Q03413|MEF2D_XENLA Myocyte-specific enhancer factor 2D homolog OS=Xenopus laevis GN=mef2d PE=1 SV=1 1 115 6.0E-23
sp|O89038|MEF2D_RAT Myocyte-specific enhancer factor 2D OS=Rattus norvegicus GN=Mef2d PE=1 SV=1 1 111 4.0E-22
sp|Q63943|MEF2D_MOUSE Myocyte-specific enhancer factor 2D OS=Mus musculus GN=Mef2d PE=1 SV=2 1 111 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12224|RLM1_YEAST Transcription factor RLM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLM1 PE=1 SV=1 1 84 3.0E-27
sp|P38128|SMP1_YEAST Transcription factor SMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMP1 PE=1 SV=1 1 70 1.0E-26
sp|Q03413|MEF2D_XENLA Myocyte-specific enhancer factor 2D homolog OS=Xenopus laevis GN=mef2d PE=1 SV=1 1 115 6.0E-23
sp|O89038|MEF2D_RAT Myocyte-specific enhancer factor 2D OS=Rattus norvegicus GN=Mef2d PE=1 SV=1 1 111 4.0E-22
sp|Q63943|MEF2D_MOUSE Myocyte-specific enhancer factor 2D OS=Mus musculus GN=Mef2d PE=1 SV=2 1 111 5.0E-22
sp|Q14814|MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens GN=MEF2D PE=1 SV=1 1 111 6.0E-22
sp|A4UTP7|MEF2C_PIG Myocyte-specific enhancer factor 2C OS=Sus scrofa GN=MEF2C PE=2 SV=1 1 136 8.0E-22
sp|Q60929|MEF2A_MOUSE Myocyte-specific enhancer factor 2A OS=Mus musculus GN=Mef2a PE=1 SV=2 1 100 1.0E-21
sp|Q5REW7|MEF2A_PONAB Myocyte-specific enhancer factor 2A OS=Pongo abelii GN=MEF2A PE=2 SV=1 1 100 2.0E-21
sp|Q9W6U8|MEF2A_CHICK Myocyte-specific enhancer factor 2A OS=Gallus gallus GN=MEF2A PE=2 SV=1 1 100 3.0E-21
sp|A2VDZ3|MEF2A_BOVIN Myocyte-specific enhancer factor 2A OS=Bos taurus GN=MEF2A PE=2 SV=1 1 84 5.0E-21
sp|Q02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens GN=MEF2A PE=1 SV=1 1 84 6.0E-21
sp|Q2MJT0|MEF2A_RAT Myocyte-specific enhancer factor 2A OS=Rattus norvegicus GN=Mef2a PE=1 SV=1 1 84 7.0E-21
sp|A2ICN5|MEF2A_PIG Myocyte-specific enhancer factor 2A OS=Sus scrofa GN=MEF2A PE=2 SV=2 1 105 7.0E-21
sp|O55087|MEF2B_MOUSE Myocyte-specific enhancer factor 2B OS=Mus musculus GN=Mef2b PE=1 SV=1 1 84 9.0E-21
sp|Q8CFN5|MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus GN=Mef2c PE=1 SV=2 1 84 1.0E-20
sp|Q5R444|MEF2C_PONAB Myocyte-specific enhancer factor 2C OS=Pongo abelii GN=MEF2C PE=2 SV=1 1 84 1.0E-20
sp|Q06413|MEF2C_HUMAN Myocyte-specific enhancer factor 2C OS=Homo sapiens GN=MEF2C PE=1 SV=1 1 84 1.0E-20
sp|Q2KIA0|MEF2C_BOVIN Myocyte-specific enhancer factor 2C OS=Bos taurus GN=MEF2C PE=2 SV=1 1 84 1.0E-20
sp|Q03414|MEF2A_XENLA Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis GN=mef2a PE=1 SV=2 1 84 2.0E-20
sp|Q02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B OS=Homo sapiens GN=MEF2B PE=1 SV=2 1 84 3.0E-20
sp|P40791|MEF2_DROME Myocyte-specific enhancer factor 2 OS=Drosophila melanogaster GN=Mef2 PE=1 SV=3 1 69 4.0E-20
sp|Q9XGJ4|GGM13_GNEGN MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 PE=2 SV=1 1 70 2.0E-19
sp|Q55F37|SRFC_DICDI Transcription factor mef2A OS=Dictyostelium discoideum GN=mef2A PE=2 SV=2 1 69 9.0E-19
sp|Q38836|AGL11_ARATH Agamous-like MADS-box protein AGL11 OS=Arabidopsis thaliana GN=AGL11 PE=1 SV=1 1 70 1.0E-18
sp|Q38847|AGL15_ARATH Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana GN=AGL15 PE=1 SV=1 1 83 2.0E-18
sp|Q8VWM8|M17_MAIZE MADS-box protein ZMM17 OS=Zea mays GN=M17 PE=2 SV=1 1 78 4.0E-18
sp|Q40704|MADS3_ORYSJ MADS-box transcription factor 3 OS=Oryza sativa subsp. japonica GN=MADS3 PE=2 SV=1 1 70 5.0E-18
sp|Q39295|AGL15_BRANA Agamous-like MADS-box protein AGL15 OS=Brassica napus GN=AGL15 PE=3 SV=1 1 69 5.0E-18
sp|Q40168|AG_SOLLC Floral homeotic protein AGAMOUS OS=Solanum lycopersicum GN=AG1 PE=2 SV=1 1 70 8.0E-18
sp|P29381|AGL1_ARATH Agamous-like MADS-box protein AGL1 OS=Arabidopsis thaliana GN=AGL1 PE=1 SV=1 1 70 1.0E-17
sp|Q03489|AGL9_PETHY Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2 1 70 1.0E-17
sp|P29385|AGL5_ARATH Agamous-like MADS-box protein AGL5 OS=Arabidopsis thaliana GN=AGL5 PE=1 SV=1 1 70 2.0E-17
sp|O82794|AGL24_ARATH MADS-box protein AGL24 OS=Arabidopsis thaliana GN=AGL24 PE=1 SV=1 1 81 2.0E-17
sp|P29382|SEP1_ARATH Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2 1 82 2.0E-17
sp|Q39685|CMB1_DIACA MADS-box protein CMB1 OS=Dianthus caryophyllus GN=CMB1 PE=2 SV=1 1 70 2.0E-17
sp|P29384|SEP2_ARATH Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1 1 82 3.0E-17
sp|Q9FUY6|JOIN_SOLLC MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1 1 72 4.0E-17
sp|Q0J466|MADS7_ORYSJ MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2 1 70 4.0E-17
sp|P0C5B0|MADS7_ORYSI MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2 1 70 4.0E-17
sp|P17839|AG_ARATH Floral homeotic protein AGAMOUS OS=Arabidopsis thaliana GN=AG PE=1 SV=2 2 70 4.0E-17
sp|Q84NC5|MAD25_ORYSJ MADS-box transcription factor 25 OS=Oryza sativa subsp. japonica GN=MADS25 PE=2 SV=2 1 73 4.0E-17
sp|Q6H711|MAD29_ORYSJ MADS-box transcription factor 29 OS=Oryza sativa subsp. japonica GN=MADS29 PE=2 SV=1 1 70 4.0E-17
sp|O22456|SEP3_ARATH Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1 1 70 4.0E-17
sp|Q2V0P1|MAD58_ORYSJ MADS-box transcription factor 58 OS=Oryza sativa subsp. japonica GN=MADS58 PE=2 SV=1 3 70 4.0E-17
sp|Q40885|AG_PETHY Floral homeotic protein AGAMOUS OS=Petunia hybrida GN=AG1 PE=1 SV=1 1 70 5.0E-17
sp|Q43585|AG_TOBAC Floral homeotic protein AGAMOUS OS=Nicotiana tabacum GN=AG1 PE=2 SV=1 1 70 5.0E-17
sp|O65874|MTF1_PEA MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1 1 70 5.0E-17
sp|Q6EU39|MADS6_ORYSJ MADS-box transcription factor 6 OS=Oryza sativa subsp. japonica GN=MADS6 PE=1 SV=1 1 76 6.0E-17
sp|Q01540|AG_BRANA Floral homeotic protein AGAMOUS OS=Brassica napus GN=AG1 PE=2 SV=1 2 70 6.0E-17
sp|O04067|AGL9_SINAL Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1 1 70 7.0E-17
sp|Q9FVC1|SVP_ARATH MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1 1 72 7.0E-17
sp|Q40872|AG_PANGI Floral homeotic protein AGAMOUS OS=Panax ginseng GN=AG2 PE=2 SV=1 1 70 8.0E-17
sp|Q38694|AGL9_ARADE Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1 1 70 1.0E-16
sp|Q6VAM4|MAD23_ORYSJ MADS-box transcription factor 23 OS=Oryza sativa subsp. japonica GN=MADS23 PE=2 SV=1 1 76 1.0E-16
sp|Q9SAR1|MADS8_ORYSJ MADS-box transcription factor 8 OS=Oryza sativa subsp. japonica GN=MADS8 PE=1 SV=1 1 70 1.0E-16
sp|P29383|AGL3_ARATH Agamous-like MADS-box protein AGL3 OS=Arabidopsis thaliana GN=AGL3 PE=2 SV=2 1 72 1.0E-16
sp|Q42464|AGL9_SOLLC Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1 1 70 1.0E-16
sp|Q0D4T4|MAD18_ORYSJ MADS-box transcription factor 18 OS=Oryza sativa subsp. japonica GN=MADS18 PE=1 SV=1 1 72 4.0E-16
sp|A2YNI2|MAD18_ORYSI MADS-box transcription factor 18 OS=Oryza sativa subsp. indica GN=MADS18 PE=2 SV=2 1 72 4.0E-16
sp|P0DI14|AP1_BRARP Floral homeotic protein APETALA 1 OS=Brassica rapa subsp. pekinensis GN=AP1 PE=3 SV=1 1 70 4.0E-16
sp|Q9M2K8|AGL18_ARATH Agamous-like MADS-box protein AGL18 OS=Arabidopsis thaliana GN=AGL18 PE=2 SV=1 1 79 4.0E-16
sp|Q39371|3AP1_BRAOL Floral homeotic protein APETALA 1 OS=Brassica oleracea GN=AP1 PE=2 SV=1 1 70 5.0E-16
sp|Q8GTF4|AP1C_BRAOB Floral homeotic protein APETALA 1 C OS=Brassica oleracea var. botrytis GN=AP1C PE=2 SV=1 1 70 5.0E-16
sp|B4YPV4|AP1C_BRAOA Floral homeotic protein APETALA 1 C OS=Brassica oleracea var. alboglabra GN=AP1C PE=3 SV=1 1 70 5.0E-16
sp|Q96355|1AP1_BRAOT Floral homeotic protein APETALA 1-1 OS=Brassica oleracea var. italica GN=1AP1 PE=2 SV=1 1 70 5.0E-16
sp|Q6EP49|MAD27_ORYSJ MADS-box transcription factor 27 OS=Oryza sativa subsp. japonica GN=MADS27 PE=2 SV=2 1 69 6.0E-16
sp|P29386|AGL6_ARATH Agamous-like MADS-box protein AGL6 OS=Arabidopsis thaliana GN=AGL6 PE=1 SV=2 1 69 9.0E-16
sp|Q9SBK9|CAL_BRARP Transcription factor CAULIFLOWER OS=Brassica rapa subsp. pekinensis GN=CAL PE=2 SV=1 1 70 1.0E-15
sp|Q6R4S3|CAL_BRARR Transcription factor CAULIFLOWER OS=Brassica rapa subsp. rapa GN=CAL PE=2 SV=1 1 70 1.0E-15
sp|Q6R4S6|CAL_BRARC Transcription factor CAULIFLOWER OS=Brassica rapa subsp. chinensis GN=CAL PE=2 SV=1 1 70 1.0E-15
sp|Q8RU31|MAD21_ORYSJ MADS-box transcription factor 21 OS=Oryza sativa subsp. japonica GN=MADS21 PE=2 SV=1 1 70 2.0E-15
sp|Q6R4R6|CALD_BRAOB Truncated transcription factor CAULIFLOWER D OS=Brassica oleracea var. botrytis GN=CAL-D PE=2 SV=1 1 72 2.0E-15
sp|Q6R4R7|CALC_BRAOB Truncated transcription factor CAULIFLOWER C OS=Brassica oleracea var. botrytis GN=CAL-C PE=2 SV=1 1 72 2.0E-15
sp|Q6R4R9|CALA_BRAOB Truncated transcription factor CAULIFLOWER A OS=Brassica oleracea var. botrytis GN=CAL-A PE=2 SV=2 1 72 2.0E-15
sp|Q6Z6W2|MAD57_ORYSJ MADS-box transcription factor 57 OS=Oryza sativa subsp. japonica GN=MADS57 PE=2 SV=2 1 69 2.0E-15
sp|Q41274|AGL8_SINAL Agamous-like MADS-box protein AGL8 homolog OS=Sinapis alba GN=AGL8 PE=2 SV=1 1 69 2.0E-15
sp|Q6R4R8|CALB_BRAOB Truncated transcription factor CAULIFLOWER B OS=Brassica oleracea var. botrytis GN=CAL-B PE=2 SV=1 1 72 2.0E-15
sp|Q7XUN2|MAD17_ORYSJ MADS-box transcription factor 17 OS=Oryza sativa subsp. japonica GN=MADS17 PE=1 SV=2 1 69 3.0E-15
sp|Q38876|AGL8_ARATH Agamous-like MADS-box protein AGL8 OS=Arabidopsis thaliana GN=AGL8 PE=1 SV=1 1 69 3.0E-15
sp|O22328|AGL8_SOLCO Agamous-like MADS-box protein AGL8 homolog OS=Solanum commersonii GN=SCM1 PE=2 SV=1 1 83 3.0E-15
sp|D7KWY6|AP1_ARALL Floral homeotic protein APETALA 1 OS=Arabidopsis lyrata subsp. lyrata GN=AP1 PE=3 SV=1 1 70 4.0E-15
sp|Q41276|AP1_SINAL Floral homeotic protein APETALA 1 OS=Sinapis alba GN=AP1 PE=2 SV=1 1 70 4.0E-15
sp|Q9HGP0|PVG4_SCHPO MADS-box transcription factor pvg4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pvg4 PE=3 SV=1 1 87 4.0E-15
sp|P35631|AP1_ARATH Floral homeotic protein APETALA 1 OS=Arabidopsis thaliana GN=AP1 PE=1 SV=2 1 70 4.0E-15
sp|Q8GTF5|AP1A_BRAOB Floral homeotic protein APETALA 1 A OS=Brassica oleracea var. botrytis GN=AP1A PE=2 SV=1 1 70 4.0E-15
sp|B4YPW6|AP1A_BRAOA Floral homeotic protein APETALA 1 A OS=Brassica oleracea var. alboglabra GN=AP1A PE=3 SV=1 1 70 4.0E-15
sp|Q96356|2AP1_BRAOT Floral homeotic protein APETALA 1-2 OS=Brassica oleracea var. italica GN=2AP1 PE=2 SV=1 1 70 4.0E-15
sp|Q10CQ1|MAD14_ORYSJ MADS-box transcription factor 14 OS=Oryza sativa subsp. japonica GN=MADS14 PE=1 SV=2 1 72 4.0E-15
sp|Q42429|AGL8_SOLTU Agamous-like MADS-box protein AGL8 homolog OS=Solanum tuberosum PE=2 SV=1 1 70 5.0E-15
sp|A2RVQ5|AGL16_ARATH Agamous-like MADS-box protein AGL16 OS=Arabidopsis thaliana GN=AGL16 PE=1 SV=1 1 69 6.0E-15
sp|A2IB53|AP1_CITSI Floral homeotic protein APETALA 1 OS=Citrus sinensis GN=AP1 PE=2 SV=1 1 70 1.0E-14
sp|Q2QW53|MAD13_ORYSJ MADS-box transcription factor 13 OS=Oryza sativa subsp. japonica GN=MADS13 PE=1 SV=2 1 70 1.0E-14
sp|Q39375|CAL_BRAOT Transcription factor CAULIFLOWER OS=Brassica oleracea var. italica GN=CAL PE=2 SV=1 1 70 1.0E-14
sp|Q9ATE5|FBP24_PETHY MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24 PE=1 SV=1 1 69 1.0E-14
sp|Q40702|MADS2_ORYSJ MADS-box transcription factor 2 OS=Oryza sativa subsp. japonica GN=MADS2 PE=2 SV=1 1 70 1.0E-14
sp|P35632|AP3_ARATH Floral homeotic protein APETALA 3 OS=Arabidopsis thaliana GN=AP3 PE=1 SV=1 1 70 1.0E-14
sp|Q03416|GLOB_TOBAC Floral homeotic protein GLOBOSA OS=Nicotiana tabacum GN=GLO PE=2 SV=1 1 70 2.0E-14
sp|Q03488|FBP1_PETHY Floral homeotic protein FBP1 OS=Petunia hybrida GN=FBP1 PE=2 SV=1 1 70 2.0E-14
sp|Q9XJ66|MAD22_ORYSJ MADS-box transcription factor 22 OS=Oryza sativa subsp. japonica GN=MADS22 PE=2 SV=1 1 72 2.0E-14
sp|P0C5B1|MAD14_ORYSI MADS-box transcription factor 14 OS=Oryza sativa subsp. indica GN=MADS14 PE=2 SV=1 1 72 2.0E-14
sp|Q2QQA3|MAD20_ORYSJ MADS-box transcription factor 20 OS=Oryza sativa subsp. japonica GN=MADS20 PE=2 SV=2 1 77 2.0E-14
sp|Q39081|CAL_ARATH Transcription factor CAULIFLOWER OS=Arabidopsis thaliana GN=CAL PE=1 SV=3 1 70 2.0E-14
sp|Q6Q9I2|MAD15_ORYSJ MADS-box transcription factor 15 OS=Oryza sativa subsp. japonica GN=MADS15 PE=1 SV=2 1 70 2.0E-14
sp|Q38837|AGL13_ARATH Agamous-like MADS-box protein AGL13 OS=Arabidopsis thaliana GN=AGL13 PE=2 SV=2 1 69 2.0E-14
sp|Q40170|AGL8_SOLLC Agamous-like MADS-box protein AGL8 homolog OS=Solanum lycopersicum GN=TDR4 PE=2 SV=1 1 83 4.0E-14
sp|Q10PZ9|MADS1_ORYSJ MADS-box transcription factor 1 OS=Oryza sativa subsp. japonica GN=MADS1 PE=1 SV=1 1 70 5.0E-14
sp|A2XDY1|MADS1_ORYSI MADS-box transcription factor 1 OS=Oryza sativa subsp. indica GN=MADS1 PE=2 SV=2 1 70 5.0E-14
sp|Q0DEB8|MADS5_ORYSJ MADS-box transcription factor 5 OS=Oryza sativa subsp. japonica GN=MADS5 PE=1 SV=1 1 70 5.0E-14
sp|A2Y9P0|MADS5_ORYSI MADS-box transcription factor 5 OS=Oryza sativa subsp. indica GN=MADS5 PE=2 SV=1 1 70 5.0E-14
sp|Q38840|AGL17_ARATH Agamous-like MADS-box protein AGL17 OS=Arabidopsis thaliana GN=AGL17 PE=2 SV=2 1 69 7.0E-14
sp|Q9SZJ6|AGL21_ARATH Agamous-like MADS-box protein AGL21 OS=Arabidopsis thaliana GN=AGL21 PE=1 SV=1 1 69 7.0E-14
sp|Q9SI38|ANR1_ARATH MADS-box transcription factor ANR1 OS=Arabidopsis thaliana GN=ANR1 PE=1 SV=1 1 69 8.0E-14
sp|Q9FPN7|AGL31_ARATH Agamous-like MADS-box protein AGL31 OS=Arabidopsis thaliana GN=AGL31 PE=2 SV=2 1 72 9.0E-14
sp|Q07474|MADS2_PETHY Floral homeotic protein PMADS 2 OS=Petunia hybrida GN=PMADS2 PE=2 SV=1 1 70 1.0E-13
sp|Q2QW55|MAD33_ORYSJ MADS-box transcription factor 33 OS=Oryza sativa subsp. japonica GN=MADS33 PE=2 SV=2 1 70 1.0E-13
sp|D7KQR8|CAL_ARALL Transcription factor CAULIFLOWER OS=Arabidopsis lyrata subsp. lyrata GN=CAL PE=3 SV=1 1 70 1.0E-13
sp|O64645|SOC1_ARATH MADS-box protein SOC1 OS=Arabidopsis thaliana GN=SOC1 PE=1 SV=1 1 72 1.0E-13
sp|P23706|DEFA_ANTMA Floral homeotic protein DEFICIENS OS=Antirrhinum majus GN=DEFA PE=1 SV=1 1 70 2.0E-13
sp|Q8RVL4|DEF21_ANTMA MADS-box protein defh21 OS=Antirrhinum majus GN=DEFH21 PE=2 SV=1 1 69 2.0E-13
sp|Q0J8G8|MAD26_ORYSJ MADS-box transcription factor 26 OS=Oryza sativa subsp. japonica GN=MADS26 PE=2 SV=1 1 70 2.0E-13
sp|A2YQK9|MAD26_ORYSI MADS-box transcription factor 26 OS=Oryza sativa subsp. indica GN=MADS26 PE=2 SV=2 1 70 2.0E-13
sp|Q5K4R0|MAD47_ORYSJ MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2 3 90 2.0E-13
sp|Q6Q9H6|MAD34_ORYSJ MADS-box transcription factor 34 OS=Oryza sativa subsp. japonica GN=MADS34 PE=2 SV=2 1 72 4.0E-13
sp|Q683D7|MAF5_ARATH Protein MADS AFFECTING FLOWERING 5 OS=Arabidopsis thaliana GN=MAF5 PE=2 SV=2 1 72 4.0E-13
sp|Q1PFC2|AGL66_ARATH Agamous-like MADS-box protein AGL66 OS=Arabidopsis thaliana GN=AGL66 PE=1 SV=1 1 69 5.0E-13
sp|P48007|PIST_ARATH Floral homeotic protein PISTILLATA OS=Arabidopsis thaliana GN=PI PE=1 SV=1 1 70 5.0E-13
sp|Q944S9|MAD16_ORYSJ MADS-box transcription factor 16 OS=Oryza sativa subsp. japonica GN=MADS16 PE=1 SV=2 1 70 6.0E-13
sp|O82743|AGL19_ARATH Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana GN=AGL19 PE=1 SV=1 1 70 7.0E-13
sp|Q84NC2|MAD31_ORYSJ MADS-box transcription factor 31 OS=Oryza sativa subsp. japonica GN=MADS31 PE=2 SV=1 1 69 1.0E-12
sp|Q9LM46|AG104_ARATH Agamous-like MADS-box protein AGL104 OS=Arabidopsis thaliana GN=AGL104 PE=1 SV=1 1 69 2.0E-12
sp|Q9S7Q7|FLC_ARATH MADS-box protein FLOWERING LOCUS C OS=Arabidopsis thaliana GN=FLC PE=2 SV=1 1 69 4.0E-12
sp|Q03378|GLOB_ANTMA Floral homeotic protein GLOBOSA OS=Antirrhinum majus GN=GLO PE=1 SV=1 1 70 9.0E-12
sp|Q69TG5|MAD55_ORYSJ MADS-box transcription factor 55 OS=Oryza sativa subsp. japonica GN=MADS55 PE=2 SV=2 17 72 1.0E-11
sp|Q655V4|MAD30_ORYSJ MADS-box transcription factor 30 OS=Oryza sativa subsp. japonica GN=MADS30 PE=2 SV=1 1 71 2.0E-11
sp|Q54QY7|SRFD_DICDI Serum factor response D OS=Dictyostelium discoideum GN=srfD PE=3 SV=1 1 98 3.0E-11
sp|Q9XJ60|MAD50_ORYSJ MADS-box transcription factor 50 OS=Oryza sativa subsp. japonica GN=MADS50 PE=2 SV=1 1 72 4.0E-11
sp|Q8RYD9|TT16_ARATH Protein TRANSPARENT TESTA 16 OS=Arabidopsis thaliana GN=TT16 PE=1 SV=1 1 69 4.0E-11
sp|Q38838|AGL14_ARATH Agamous-like MADS-box protein AGL14 OS=Arabidopsis thaliana GN=AGL14 PE=1 SV=2 1 70 5.0E-11
sp|Q8S151|MAD32_ORYSJ MADS-box transcription factor 32 OS=Oryza sativa subsp. japonica GN=MADS32 PE=2 SV=1 1 70 7.0E-11
sp|O64703|AGL29_ARATH Agamous-like MADS-box protein AGL29 OS=Arabidopsis thaliana GN=AGL29 PE=2 SV=1 1 69 7.0E-11
sp|Q42498|CMB2_DIACA MADS-box protein CMB2 OS=Dianthus caryophyllus GN=CMB2 PE=2 SV=1 1 70 1.0E-10
sp|Q40703|MADS4_ORYSJ MADS-box transcription factor 4 OS=Oryza sativa subsp. japonica GN=MADS4 PE=1 SV=3 1 70 1.0E-10
sp|Q5AFP3|MCM1_CANAL Transcription factor of morphogenesis MCM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCM1 PE=1 SV=1 3 99 2.0E-10
sp|P0C5B2|MAD56_ORYSJ MADS-box transcription factor 56 OS=Oryza sativa subsp. japonica GN=MADS56 PE=2 SV=1 1 90 4.0E-10
sp|A2Z9Q7|MAD56_ORYSI MADS-box transcription factor 56 OS=Oryza sativa subsp. indica GN=MADS56 PE=2 SV=2 1 90 4.0E-10
sp|Q38841|AGL12_ARATH Agamous-like MADS-box protein AGL12 OS=Arabidopsis thaliana GN=AGL12 PE=2 SV=2 1 69 5.0E-10
sp|Q9AT76|AGL27_ARATH Agamous-like MADS-box protein AGL27 OS=Arabidopsis thaliana GN=AGL27 PE=1 SV=1 1 72 7.0E-10
sp|Q07472|MADS1_PETHY Floral homeotic protein PMADS 1 OS=Petunia hybrida GN=PMADS1 PE=2 SV=1 1 59 9.0E-10
sp|Q7X9I0|AGL65_ARATH Agamous-like MADS-box protein AGL65 OS=Arabidopsis thaliana GN=AGL65 PE=1 SV=1 1 48 1.0E-09
sp|Q9FKK2|AGL62_ARATH Agamous-like MADS-box protein AGL62 OS=Arabidopsis thaliana GN=AGL62 PE=1 SV=1 2 69 2.0E-09
sp|Q1PFA4|AGL30_ARATH Agamous-like MADS-box protein AGL30 OS=Arabidopsis thaliana GN=AGL30 PE=1 SV=1 1 48 4.0E-09
sp|Q9LMM8|AGL28_ARATH Agamous-like MADS-box protein AGL28 OS=Arabidopsis thaliana GN=AGL28 PE=2 SV=1 1 48 4.0E-09
sp|O42954|MBX1_SCHPO MADS-box transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mbx1 PE=1 SV=2 8 69 2.0E-08
sp|O80807|AGL23_ARATH Agamous-like MADS-box protein AGL23 OS=Arabidopsis thaliana GN=AGL23 PE=2 SV=1 1 48 2.0E-08
sp|P11746|MCM1_YEAST Pheromone receptor transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM1 PE=1 SV=2 3 59 3.0E-08
sp|Q54TY7|SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum GN=srfA PE=1 SV=1 2 68 2.0E-07
sp|Q4PSU4|AGL61_ARATH Agamous-like MADS-box protein AGL61 OS=Arabidopsis thaliana GN=AGL61 PE=1 SV=1 1 48 3.0E-07
sp|P07249|ARGR1_YEAST Arginine metabolism regulation protein I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG80 PE=1 SV=2 1 59 7.0E-07
sp|Q54RY6|SRFB_DICDI Serum response factor homolog B OS=Dictyostelium discoideum GN=srfB PE=3 SV=1 2 68 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3687 0.9623 0.0242 0.032 0.057 0.0004 0.0244 0.0214 0.0031 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
SRF-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup712
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5399
Ophiocordyceps australis map64 (Brazil) OphauB2|1547
Ophiocordyceps camponoti-floridani Ophcf2|02463
Ophiocordyceps camponoti-rufipedis Ophun1|1366
Ophiocordyceps camponoti-rufipedis Ophun1|2764
Ophiocordyceps kimflemingae Ophio5|3931 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1507

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3931
MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELSVLCSVDVAVFIFGNNKKLYEYSSTDMRELVQRYQMHGTI
NEHKGPADFNGGNDDDDDDDADGSPPRGSDGVQMMPPQFGPGQHPPFSQILRHNAPSASPPIAHGVPYQPHHVAQ
PHPRGATPQPVMGPRPSSSNDVRRVGPGMPPHPVPGPHASHPASHSASHPGITYIPTPPIYNPPGGQPSIVPQHG
GQYSYPPQSQQPYVEDRRPSAPPTYATQHPPPPPPPPPQAAAAVARTEPSPPLPSAQKHVPPHSAAQASVSSSQP
GRERRPQDSQPPAPVEPKTETPSEWPPVHADTAIKKMPQRKSHSIFTPIEENRSILYLHAASFATDPQAVKGETG
PSATSAPPPPPPPKRSPSADAPSGDGAPTSPQLKRSSTQSSLDKSQNPPASAASETAAPTPPSRSNSNVGGPPAG
ASRSRGPRLTVQIPDGESEPGSATGESNSPNNPAMTPTQAPQRSSSHSSVVLPPPSPSASALLSAGATGPPNPFA
RPPPQQNVNGDTPASALPSRFLNEQLLPSPSSFYPDWNFRSSDSNTLPSPLNFATPVVGSGPSFLRDDGHPVGSS
SAVTSGHAASHLSSGLGKRKSPDFGIGGHGDGHAVPSEPKRVKVEYA
Coding >Ophio5|3931
ATGGGGCGCAGAAAGATCGAGATCAAAGCCATCAAGGATGATCGCAATCGCTCCGTCACCTTTTTGAAGCGAAAA
GGAGGCCTGTTCAAAAAGGCCCACGAGCTGTCCGTCCTATGTTCCGTCGACGTGGCCGTCTTCATCTTCGGCAAC
AACAAGAAGCTCTATGAGTATTCGTCGACGGATATGCGCGAGCTCGTCCAGCGCTACCAGATGCACGGCACCATC
AACGAGCACAAGGGCCCTGCCGACTTCAATGGCGGCAACGACGACGATGACGATGACGACGCCGACGGAAGCCCT
CCTCGCGGCTCCGACGGTGTCCAGATGATGCCGCCCCAATTCGGCCCTGGCCAGCACCCTCCCTTTTCCCAGATC
CTCCGCCATAACGCGCCCTCAGCCTCGCCTCCTATTGCCCACGGCGTCCCCTACCAGCCACATCATGTCGCTCAA
CCTCACCCTCGCGGTGCCACGCCACAGCCGGTTATGGGTCCGCGCCCCAGCTCCAGCAACGACGTCCGCCGCGTG
GGGCCCGGAATGCCTCCCCATCCCGTCCCCGGCCCTCATGCTTCGCATCCGGCCTCACACTCGGCTTCGCATCCG
GGCATCACTTACATTCCCACGCCGCCCATCTACAACCCGCCCGGTGGCCAGCCCTCTATCGTGCCTCAACACGGA
GGTCAGTACTCTTATCCACCGCAGTCGCAGCAGCCCTACGTCGAGGACCGCCGTCCTTCGGCGCCCCCGACCTAT
GCCACCCAGCATCCTCCTCCGCCGCCGCCGCCGCCACCCCAGGCTGCCGCAGCCGTCGCCCGCACCGAACCGTCG
CCGCCTCTGCCCAGTGCTCAAAAGCATGTGCCTCCTCACTCTGCAGCCCAGGCCTCCGTCTCCTCTTCGCAACCG
GGCCGCGAGCGGCGTCCACAAGATTCTCAGCCTCCCGCGCCCGTCGAGCCCAAGACCGAGACGCCCTCGGAGTGG
CCGCCAGTGCATGCGGACACGGCCATCAAAAAGATGCCTCAACGCAAGTCCCACAGCATCTTCACCCCGATCGAG
GAGAACCGGTCAATTCTTTATCTGCACGCCGCCTCCTTCGCCACCGACCCCCAGGCCGTCAAGGGTGAGACGGGC
CCGTCCGCGACCTCGGCGCCCCCGCCGCCCCCACCGCCGAAGCGCTCTCCATCGGCTGACGCTCCGTCCGGCGAT
GGGGCACCGACATCGCCTCAGCTAAAGCGGTCGAGCACGCAGAGCAGCCTCGACAAATCACAGAATCCTCCGGCA
TCGGCGGCCTCTGAAACGGCGGCGCCAACGCCGCCTTCCCGATCCAACAGCAACGTCGGCGGGCCGCCGGCGGGC
GCATCACGGTCGAGAGGCCCGCGACTGACAGTGCAGATTCCGGACGGAGAATCGGAGCCGGGTAGTGCAACGGGA
GAGTCCAACTCACCCAATAACCCGGCCATGACGCCGACGCAGGCGCCACAGCGGAGCAGTTCGCACTCGTCCGTC
GTCCTCCCGCCTCCCTCGCCCTCGGCATCGGCCCTGCTGTCGGCCGGGGCCACGGGCCCTCCGAACCCCTTTGCC
CGGCCGCCGCCCCAACAGAACGTCAACGGTGACACGCCCGCGTCGGCGCTGCCGTCGCGCTTTCTTAACGAGCAG
CTGCTCCCCAGCCCCAGCAGCTTCTACCCGGACTGGAACTTTCGCAGCAGCGACAGCAATACTCTGCCGAGCCCT
CTGAACTTTGCCACGCCCGTCGTCGGGTCCGGGCCGAGCTTTCTCCGGGACGACGGCCACCCCGTCGGCAGCAGC
TCGGCCGTGACGTCCGGCCATGCGGCCTCGCACTTGTCGTCGGGTCTCGGGAAGCGCAAGTCGCCCGACTTCGGC
ATCGGTGGCCACGGCGACGGTCACGCAGTGCCAAGTGAGCCCAAGCGGGTCAAAGTCGAGTACGCG
Transcript >Ophio5|3931
ATGGGGCGCAGAAAGATCGAGATCAAAGCCATCAAGGATGATCGCAATCGCTCCGTCACCTTTTTGAAGCGAAAA
GGAGGCCTGTTCAAAAAGGCCCACGAGCTGTCCGTCCTATGTTCCGTCGACGTGGCCGTCTTCATCTTCGGCAAC
AACAAGAAGCTCTATGAGTATTCGTCGACGGATATGCGCGAGCTCGTCCAGCGCTACCAGATGCACGGCACCATC
AACGAGCACAAGGGCCCTGCCGACTTCAATGGCGGCAACGACGACGATGACGATGACGACGCCGACGGAAGCCCT
CCTCGCGGCTCCGACGGTGTCCAGATGATGCCGCCCCAATTCGGCCCTGGCCAGCACCCTCCCTTTTCCCAGATC
CTCCGCCATAACGCGCCCTCAGCCTCGCCTCCTATTGCCCACGGCGTCCCCTACCAGCCACATCATGTCGCTCAA
CCTCACCCTCGCGGTGCCACGCCACAGCCGGTTATGGGTCCGCGCCCCAGCTCCAGCAACGACGTCCGCCGCGTG
GGGCCCGGAATGCCTCCCCATCCCGTCCCCGGCCCTCATGCTTCGCATCCGGCCTCACACTCGGCTTCGCATCCG
GGCATCACTTACATTCCCACGCCGCCCATCTACAACCCGCCCGGTGGCCAGCCCTCTATCGTGCCTCAACACGGA
GGTCAGTACTCTTATCCACCGCAGTCGCAGCAGCCCTACGTCGAGGACCGCCGTCCTTCGGCGCCCCCGACCTAT
GCCACCCAGCATCCTCCTCCGCCGCCGCCGCCGCCACCCCAGGCTGCCGCAGCCGTCGCCCGCACCGAACCGTCG
CCGCCTCTGCCCAGTGCTCAAAAGCATGTGCCTCCTCACTCTGCAGCCCAGGCCTCCGTCTCCTCTTCGCAACCG
GGCCGCGAGCGGCGTCCACAAGATTCTCAGCCTCCCGCGCCCGTCGAGCCCAAGACCGAGACGCCCTCGGAGTGG
CCGCCAGTGCATGCGGACACGGCCATCAAAAAGATGCCTCAACGCAAGTCCCACAGCATCTTCACCCCGATCGAG
GAGAACCGGTCAATTCTTTATCTGCACGCCGCCTCCTTCGCCACCGACCCCCAGGCCGTCAAGGGTGAGACGGGC
CCGTCCGCGACCTCGGCGCCCCCGCCGCCCCCACCGCCGAAGCGCTCTCCATCGGCTGACGCTCCGTCCGGCGAT
GGGGCACCGACATCGCCTCAGCTAAAGCGGTCGAGCACGCAGAGCAGCCTCGACAAATCACAGAATCCTCCGGCA
TCGGCGGCCTCTGAAACGGCGGCGCCAACGCCGCCTTCCCGATCCAACAGCAACGTCGGCGGGCCGCCGGCGGGC
GCATCACGGTCGAGAGGCCCGCGACTGACAGTGCAGATTCCGGACGGAGAATCGGAGCCGGGTAGTGCAACGGGA
GAGTCCAACTCACCCAATAACCCGGCCATGACGCCGACGCAGGCGCCACAGCGGAGCAGTTCGCACTCGTCCGTC
GTCCTCCCGCCTCCCTCGCCCTCGGCATCGGCCCTGCTGTCGGCCGGGGCCACGGGCCCTCCGAACCCCTTTGCC
CGGCCGCCGCCCCAACAGAACGTCAACGGTGACACGCCCGCGTCGGCGCTGCCGTCGCGCTTTCTTAACGAGCAG
CTGCTCCCCAGCCCCAGCAGCTTCTACCCGGACTGGAACTTTCGCAGCAGCGACAGCAATACTCTGCCGAGCCCT
CTGAACTTTGCCACGCCCGTCGTCGGGTCCGGGCCGAGCTTTCTCCGGGACGACGGCCACCCCGTCGGCAGCAGC
TCGGCCGTGACGTCCGGCCATGCGGCCTCGCACTTGTCGTCGGGTCTCGGGAAGCGCAAGTCGCCCGACTTCGGC
ATCGGTGGCCACGGCGACGGTCACGCAGTGCCAAGTGAGCCCAAGCGGGTCAAAGTCGAGTACGCGTGA
Gene >Ophio5|3931
ATGGGGCGCAGAAAGATCGAGATCAAAGCCATCAAGGATGATCGCAATCGCTCCGTGTATGTTTTCCCCTTCCGT
CCGTCGCGTCCTCGACTGACTTTCCGAAGCACCTTTTTGAAGCGAAAAGGAGGCCTGTTCAAAAAGGCCCACGAG
CTGTCCGTCCTATGTTCCGTCGACGTGGCCGTCTTCATCTTCGGCAACAACAAGAAGCTCTATGAGTATTCGTCG
ACGGATATGCGCGAGCTCGTCCAGCGCTACCAGATGGTCCGTTGCCTCCCCTTGCGGCCATTGAGCACTCTTGGT
TAACAACTGACTGCTATTTAGCACGGCACCATCAACGAGCACAAGGGCCCTGCCGACTTCAATGGCGGCAACGAC
GACGATGACGATGACGACGCCGACGGAAGCCCTCCTCGCGGCTCCGACGGTGTCCAGATGATGCCGCCCCAATTC
GGCCCTGGCCAGCACCCTCCCTTTTCCCAGATCCTCCGCCATAACGCGCCCTCAGCCTCGCCTCCTATTGCCCAC
GGCGTCCCCTACCAGCCACATCATGTCGCTCAACCTCACCCTCGCGGTGCCACGCCACAGCCGGTTATGGGTCCG
CGCCCCAGCTCCAGCAACGACGTCCGCCGCGTGGGGCCCGGAATGCCTCCCCATCCCGTCCCCGGCCCTCATGCT
TCGCATCCGGCCTCACACTCGGCTTCGCATCCGGGCATCACTTACATTCCCACGCCGCCCATCTACAACCCGCCC
GGTGGCCAGCCCTCTATCGTGCCTCAACACGGAGGTCAGTACTCTTATCCACCGCAGTCGCAGCAGCCCTACGTC
GAGGACCGCCGTCCTTCGGCGCCCCCGACCTATGCCACCCAGCATCCTCCTCCGCCGCCGCCGCCGCCACCCCAG
GCTGCCGCAGCCGTCGCCCGCACCGAACCGTCGCCGCCTCTGCCCAGTGCTCAAAAGCATGTGCCTCCTCACTCT
GCAGCCCAGGCCTCCGTCTCCTCTTCGCAACCGGGCCGCGAGCGGCGTCCACAAGATTCTCAGCCTCCCGCGCCC
GTCGAGCCCAAGACCGAGACGCCCTCGGAGTGGCCGCCAGTGCATGCGGACACGGCCATCAAAAAGATGCCTCAA
CGCAAGTCCCACAGCATCTTCACCCCGATCGAGGAGAACCGGTCAATTCTTTATCTGCACGCCGCCTCCTTCGCC
ACCGACCCCCAGGCCGTCAAGGGTGAGACGGGCCCGTCCGCGACCTCGGCGCCCCCGCCGCCCCCACCGCCGAAG
CGCTCTCCATCGGCTGACGCTCCGTCCGGCGATGGGGCACCGACATCGCCTCAGCTAAAGCGGTCGAGCACGCAG
AGCAGCCTCGACAAATCACAGAATCCTCCGGCATCGGCGGCCTCTGAAACGGCGGCGCCAACGCCGCCTTCCCGA
TCCAACAGCAACGTCGGCGGGCCGCCGGCGGGCGCATCACGGTCGAGAGGCCCGCGACTGACAGTGCAGATTCCG
GACGGAGAATCGGAGCCGGGTAGTGCAACGGGAGAGTCCAACTCACCCAATAACCCGGCCATGACGCCGACGCAG
GCGCCACAGCGGAGCAGTTCGCACTCGTCCGTCGTCCTCCCGCCTCCCTCGCCCTCGGCATCGGCCCTGCTGTCG
GCCGGGGCCACGGGCCCTCCGAACCCCTTTGCCCGGCCGCCGCCCCAACAGAACGTCAACGGTGACACGCCCGCG
TCGGCGCTGCCGTCGCGCTTTCTTAACGAGCAGCTGCTCCCCAGCCCCAGCAGCTTCTACCCGGACTGGAACTTT
CGCAGCAGCGACAGCAATACTCTGCCGAGCCCTCTGAACTTTGCCACGCCCGTCGTCGGGTCCGGGCCGAGCTTT
CTCCGGGACGACGGCCACCCCGTCGGCAGCAGCTCGGCCGTGACGTCCGGCCATGCGGCCTCGCACTTGTCGTCG
GGTCTCGGGAAGCGCAAGTCGCCCGACTTCGGCATCGGTGGCCACGGCGACGGTCACGCAGTGCCAAGTGAGCCC
AAGCGGGTCAAAGTCGAGTACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail