Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3927
Gene name
Locationscaffold_306:20123..21884
Strand-
Gene length (bp)1761
Transcript length (bp)1761
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 10.04 4.11 15.97
CcL In ants, during behavior modification 17.49 8.06 26.92
CcD In ants, recently dead 17.17 7.86 26.48

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.047686 yes
SC16a CcD 0.059063 no
CcL CcD 0.958204 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3927
MEPRRRWWWPRLGLWLRPWRILPLLLTLYCVVFILLLPLYRLRGGEGRLVGVGRTSKGGDGYRKASDRVPDTAPS
PPPPTTKTKTKTTKTVGTPEETQQKQRHLLNNTIYGPATQDMVHETWDFTASPCSRFPDTDGILLVMKTGASEAY
DKLPTQLLTSLQCLPDLLLFSDMEQQMGRYHLHDALDAVSDSIRAANKEFALYEAQRRCAVSLKDCTSSMEGAWH
LDKYKFVNMALRTWRMRPNRQWYVFAEADSYVFWQNLVTWLKTRDAESDTYVGNVALYDGFPFAHGGSGYVVSGK
LLRRLAEADGPDGTLATRFDAAAPDTCCGDVLLGMALAEVGARVGHVYPMFSGDTPTSLPFGPGLWCEPALTLHH
MSPEQVGLAWQYEQTRLRPDEPILLRDLYRQFVAPHLRRRRTAWDNLSADTCYIAPDDESQRRAAADLRALQRPH
EDKSPVESIAHRGPDACEAVCEAAGLDVDAASWAKAADEDDPGIDDAGIRRSVWLARRYNARASRSDALDFHRRR
DCFQWRYHAGVCCTSSSFKLGHPKKHPYRGKPWISGWFVRGIDDWAVAQGVCEPIWREPVQ
Coding >Ophio5|3927
ATGGAGCCCAGGCGACGATGGTGGTGGCCAAGGCTCGGCCTGTGGCTACGACCCTGGAGGATCCTGCCGCTGCTG
CTGACGCTGTATTGCGTCGTCTTCATCCTTTTGCTGCCGCTGTATCGTCTCCGCGGAGGTGAGGGTCGGCTTGTG
GGCGTCGGGCGGACGTCCAAGGGGGGGGACGGGTATCGGAAGGCTTCGGACCGGGTTCCGGATACGGCTCCGTCA
CCGCCGCCGCCGACGACCAAGACGAAGACGAAGACGACGAAGACGGTGGGCACGCCGGAAGAGACGCAGCAGAAG
CAACGGCATCTACTCAACAACACCATCTATGGTCCGGCAACCCAAGACATGGTGCACGAGACGTGGGACTTTACC
GCCTCGCCATGCTCCCGCTTCCCGGACACGGACGGTATCCTGCTGGTGATGAAGACGGGCGCGAGCGAGGCATAC
GACAAGCTTCCCACACAGCTCCTCACCAGCCTGCAATGCCTACCCGACCTCCTCCTCTTCTCCGACATGGAGCAG
CAGATGGGTCGGTACCACCTACACGACGCCCTCGACGCCGTCTCGGACTCGATCCGAGCCGCCAACAAGGAGTTC
GCGCTATACGAAGCCCAGCGTCGATGCGCCGTCTCCCTCAAGGACTGCACGTCGAGCATGGAGGGGGCCTGGCAT
CTGGACAAGTACAAGTTCGTCAACATGGCGCTGCGGACGTGGAGGATGCGTCCGAATCGTCAATGGTATGTCTTC
GCCGAGGCCGACTCGTACGTCTTTTGGCAGAATCTCGTCACCTGGCTCAAGACGCGCGACGCCGAGTCGGACACG
TACGTCGGAAACGTCGCCCTCTACGACGGGTTTCCCTTTGCCCATGGCGGTAGCGGCTACGTCGTCTCCGGCAAG
TTGTTGCGCAGACTGGCCGAGGCCGACGGTCCGGACGGGACTCTGGCCACTCGCTTCGACGCCGCCGCTCCCGAT
ACCTGCTGCGGAGACGTCCTGCTCGGTATGGCCCTCGCCGAGGTCGGCGCCCGCGTCGGACACGTCTATCCCATG
TTCAGCGGCGACACGCCCACCTCTCTCCCCTTCGGGCCCGGTCTATGGTGTGAGCCGGCCCTGACCCTTCACCAC
ATGAGTCCGGAACAGGTCGGATTGGCCTGGCAGTACGAGCAGACGCGTCTACGACCGGACGAACCGATCCTGCTA
CGAGATCTGTATCGTCAGTTCGTCGCGCCCCATCTTCGTCGACGACGTACGGCTTGGGATAACCTCTCGGCCGAC
ACCTGTTACATCGCCCCCGACGACGAAAGTCAACGACGGGCGGCCGCCGACCTGAGAGCCCTTCAGCGTCCGCAC
GAGGACAAGTCGCCGGTCGAGAGCATCGCTCATCGCGGTCCGGACGCGTGCGAGGCCGTGTGCGAGGCCGCCGGC
CTAGATGTCGATGCCGCCTCCTGGGCCAAGGCGGCCGACGAGGACGATCCCGGCATCGACGACGCCGGCATCCGA
CGTTCCGTTTGGCTTGCTCGCCGCTACAATGCCCGTGCTTCCCGATCCGATGCTCTCGACTTTCATCGTCGGAGG
GATTGCTTCCAGTGGCGATATCATGCTGGTGTCTGCTGCACCAGTTCCAGCTTCAAGCTCGGCCACCCCAAGAAG
CATCCCTATCGGGGGAAGCCTTGGATCAGCGGCTGGTTCGTCCGCGGCATCGACGATTGGGCCGTCGCTCAGGGC
GTGTGCGAGCCCATCTGGCGGGAGCCCGTGCAG
Transcript >Ophio5|3927
ATGGAGCCCAGGCGACGATGGTGGTGGCCAAGGCTCGGCCTGTGGCTACGACCCTGGAGGATCCTGCCGCTGCTG
CTGACGCTGTATTGCGTCGTCTTCATCCTTTTGCTGCCGCTGTATCGTCTCCGCGGAGGTGAGGGTCGGCTTGTG
GGCGTCGGGCGGACGTCCAAGGGGGGGGACGGGTATCGGAAGGCTTCGGACCGGGTTCCGGATACGGCTCCGTCA
CCGCCGCCGCCGACGACCAAGACGAAGACGAAGACGACGAAGACGGTGGGCACGCCGGAAGAGACGCAGCAGAAG
CAACGGCATCTACTCAACAACACCATCTATGGTCCGGCAACCCAAGACATGGTGCACGAGACGTGGGACTTTACC
GCCTCGCCATGCTCCCGCTTCCCGGACACGGACGGTATCCTGCTGGTGATGAAGACGGGCGCGAGCGAGGCATAC
GACAAGCTTCCCACACAGCTCCTCACCAGCCTGCAATGCCTACCCGACCTCCTCCTCTTCTCCGACATGGAGCAG
CAGATGGGTCGGTACCACCTACACGACGCCCTCGACGCCGTCTCGGACTCGATCCGAGCCGCCAACAAGGAGTTC
GCGCTATACGAAGCCCAGCGTCGATGCGCCGTCTCCCTCAAGGACTGCACGTCGAGCATGGAGGGGGCCTGGCAT
CTGGACAAGTACAAGTTCGTCAACATGGCGCTGCGGACGTGGAGGATGCGTCCGAATCGTCAATGGTATGTCTTC
GCCGAGGCCGACTCGTACGTCTTTTGGCAGAATCTCGTCACCTGGCTCAAGACGCGCGACGCCGAGTCGGACACG
TACGTCGGAAACGTCGCCCTCTACGACGGGTTTCCCTTTGCCCATGGCGGTAGCGGCTACGTCGTCTCCGGCAAG
TTGTTGCGCAGACTGGCCGAGGCCGACGGTCCGGACGGGACTCTGGCCACTCGCTTCGACGCCGCCGCTCCCGAT
ACCTGCTGCGGAGACGTCCTGCTCGGTATGGCCCTCGCCGAGGTCGGCGCCCGCGTCGGACACGTCTATCCCATG
TTCAGCGGCGACACGCCCACCTCTCTCCCCTTCGGGCCCGGTCTATGGTGTGAGCCGGCCCTGACCCTTCACCAC
ATGAGTCCGGAACAGGTCGGATTGGCCTGGCAGTACGAGCAGACGCGTCTACGACCGGACGAACCGATCCTGCTA
CGAGATCTGTATCGTCAGTTCGTCGCGCCCCATCTTCGTCGACGACGTACGGCTTGGGATAACCTCTCGGCCGAC
ACCTGTTACATCGCCCCCGACGACGAAAGTCAACGACGGGCGGCCGCCGACCTGAGAGCCCTTCAGCGTCCGCAC
GAGGACAAGTCGCCGGTCGAGAGCATCGCTCATCGCGGTCCGGACGCGTGCGAGGCCGTGTGCGAGGCCGCCGGC
CTAGATGTCGATGCCGCCTCCTGGGCCAAGGCGGCCGACGAGGACGATCCCGGCATCGACGACGCCGGCATCCGA
CGTTCCGTTTGGCTTGCTCGCCGCTACAATGCCCGTGCTTCCCGATCCGATGCTCTCGACTTTCATCGTCGGAGG
GATTGCTTCCAGTGGCGATATCATGCTGGTGTCTGCTGCACCAGTTCCAGCTTCAAGCTCGGCCACCCCAAGAAG
CATCCCTATCGGGGGAAGCCTTGGATCAGCGGCTGGTTCGTCCGCGGCATCGACGATTGGGCCGTCGCTCAGGGC
GTGTGCGAGCCCATCTGGCGGGAGCCCGTGCAGTGA
Gene >Ophio5|3927
ATGGAGCCCAGGCGACGATGGTGGTGGCCAAGGCTCGGCCTGTGGCTACGACCCTGGAGGATCCTGCCGCTGCTG
CTGACGCTGTATTGCGTCGTCTTCATCCTTTTGCTGCCGCTGTATCGTCTCCGCGGAGGTGAGGGTCGGCTTGTG
GGCGTCGGGCGGACGTCCAAGGGGGGGGACGGGTATCGGAAGGCTTCGGACCGGGTTCCGGATACGGCTCCGTCA
CCGCCGCCGCCGACGACCAAGACGAAGACGAAGACGACGAAGACGGTGGGCACGCCGGAAGAGACGCAGCAGAAG
CAACGGCATCTACTCAACAACACCATCTATGGTCCGGCAACCCAAGACATGGTGCACGAGACGTGGGACTTTACC
GCCTCGCCATGCTCCCGCTTCCCGGACACGGACGGTATCCTGCTGGTGATGAAGACGGGCGCGAGCGAGGCATAC
GACAAGCTTCCCACACAGCTCCTCACCAGCCTGCAATGCCTACCCGACCTCCTCCTCTTCTCCGACATGGAGCAG
CAGATGGGTCGGTACCACCTACACGACGCCCTCGACGCCGTCTCGGACTCGATCCGAGCCGCCAACAAGGAGTTC
GCGCTATACGAAGCCCAGCGTCGATGCGCCGTCTCCCTCAAGGACTGCACGTCGAGCATGGAGGGGGCCTGGCAT
CTGGACAAGTACAAGTTCGTCAACATGGCGCTGCGGACGTGGAGGATGCGTCCGAATCGTCAATGGTATGTCTTC
GCCGAGGCCGACTCGTACGTCTTTTGGCAGAATCTCGTCACCTGGCTCAAGACGCGCGACGCCGAGTCGGACACG
TACGTCGGAAACGTCGCCCTCTACGACGGGTTTCCCTTTGCCCATGGCGGTAGCGGCTACGTCGTCTCCGGCAAG
TTGTTGCGCAGACTGGCCGAGGCCGACGGTCCGGACGGGACTCTGGCCACTCGCTTCGACGCCGCCGCTCCCGAT
ACCTGCTGCGGAGACGTCCTGCTCGGTATGGCCCTCGCCGAGGTCGGCGCCCGCGTCGGACACGTCTATCCCATG
TTCAGCGGCGACACGCCCACCTCTCTCCCCTTCGGGCCCGGTCTATGGTGTGAGCCGGCCCTGACCCTTCACCAC
ATGAGTCCGGAACAGGTCGGATTGGCCTGGCAGTACGAGCAGACGCGTCTACGACCGGACGAACCGATCCTGCTA
CGAGATCTGTATCGTCAGTTCGTCGCGCCCCATCTTCGTCGACGACGTACGGCTTGGGATAACCTCTCGGCCGAC
ACCTGTTACATCGCCCCCGACGACGAAAGTCAACGACGGGCGGCCGCCGACCTGAGAGCCCTTCAGCGTCCGCAC
GAGGACAAGTCGCCGGTCGAGAGCATCGCTCATCGCGGTCCGGACGCGTGCGAGGCCGTGTGCGAGGCCGCCGGC
CTAGATGTCGATGCCGCCTCCTGGGCCAAGGCGGCCGACGAGGACGATCCCGGCATCGACGACGCCGGCATCCGA
CGTTCCGTTTGGCTTGCTCGCCGCTACAATGCCCGTGCTTCCCGATCCGATGCTCTCGACTTTCATCGTCGGAGG
GATTGCTTCCAGTGGCGATATCATGCTGGTGTCTGCTGCACCAGTTCCAGCTTCAAGCTCGGCCACCCCAAGAAG
CATCCCTATCGGGGGAAGCCTTGGATCAGCGGCTGGTTCGTCCGCGGCATCGACGATTGGGCCGTCGCTCAGGGC
GTGTGCGAGCCCATCTGGCGGGAGCCCGTGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail