Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3921
Gene name
Locationscaffold_306:9500..10640
Strand+
Gene length (bp)1140
Transcript length (bp)576
Coding sequence length (bp)573
Protein length (aa) 191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0903 0.1107 0.9222 0.2828 0.0959 0.0127 0.1896 0.0765 0.1775 0.0127

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2986
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1797
Ophiocordyceps australis map64 (Brazil) OphauB2|5259
Ophiocordyceps camponoti-floridani Ophcf2|02109
Ophiocordyceps camponoti-rufipedis Ophun1|1786
Ophiocordyceps kimflemingae Ophio5|3921 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5108

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3921
MVASFVARRLQPKKKTKGNLARRPVTQADTKKRRTPSLISRRHEAAAASHSPRHQACLSSERAKVETCPPTDYDC
LCAAHGAVATCYNNCPNDQRAPSARQAARSNCQNASMYGTKAKASKTSSMSASSTSDASATTTESDSASSTNGVM
RGASSSSTSTARPTSTGAADALSGSTGGLFMAVAGVLAALL
Coding >Ophio5|3921
ATGGTCGCATCCTTCGTTGCTCGGCGACTCCAACCGAAAAAAAAAACAAAAGGCAACCTTGCTCGTCGTCCCGTC
ACACAGGCAGATACGAAGAAGCGCAGAACGCCCTCTCTAATTAGCCGTCGTCATGAAGCTGCTGCTGCCTCTCAC
TCTCCTCGCCACCAAGCCTGCCTCTCCAGCGAAAGGGCAAAGGTCGAGACCTGCCCCCCTACCGACTACGACTGC
CTCTGTGCCGCCCACGGGGCCGTGGCCACCTGCTACAACAACTGCCCTAACGACCAGCGCGCCCCCTCCGCTCGT
CAAGCCGCCCGCAGCAACTGTCAGAACGCCTCCATGTACGGCACAAAAGCCAAGGCTTCCAAGACGTCTTCCATG
TCCGCTTCCTCCACGTCGGACGCCTCTGCCACCACCACCGAATCGGACTCTGCTTCTTCCACCAACGGCGTCATG
CGCGGCGCTTCTTCTTCCTCGACCAGCACCGCGAGGCCTACCAGCACCGGTGCCGCTGACGCCTTGTCTGGAAGT
ACCGGCGGCCTGTTTATGGCCGTCGCTGGTGTCCTGGCTGCTCTCCTG
Transcript >Ophio5|3921
ATGGTCGCATCCTTCGTTGCTCGGCGACTCCAACCGAAAAAAAAAACAAAAGGCAACCTTGCTCGTCGTCCCGTC
ACACAGGCAGATACGAAGAAGCGCAGAACGCCCTCTCTAATTAGCCGTCGTCATGAAGCTGCTGCTGCCTCTCAC
TCTCCTCGCCACCAAGCCTGCCTCTCCAGCGAAAGGGCAAAGGTCGAGACCTGCCCCCCTACCGACTACGACTGC
CTCTGTGCCGCCCACGGGGCCGTGGCCACCTGCTACAACAACTGCCCTAACGACCAGCGCGCCCCCTCCGCTCGT
CAAGCCGCCCGCAGCAACTGTCAGAACGCCTCCATGTACGGCACAAAAGCCAAGGCTTCCAAGACGTCTTCCATG
TCCGCTTCCTCCACGTCGGACGCCTCTGCCACCACCACCGAATCGGACTCTGCTTCTTCCACCAACGGCGTCATG
CGCGGCGCTTCTTCTTCCTCGACCAGCACCGCGAGGCCTACCAGCACCGGTGCCGCTGACGCCTTGTCTGGAAGT
ACCGGCGGCCTGTTTATGGCCGTCGCTGGTGTCCTGGCTGCTCTCCTGTAG
Gene >Ophio5|3921
ATGGTCGCATCCTTCGTTGCTCGGCGACTCCAACCGAAAAAAAAAACAAAAGGCAACCTTGCTCGTCGTCCCGTC
ACACAGGCAGATACGAAGAAGCGCAGAACGCCCTCTCTAATTAGGTAAACTGCAAGTGCTATGCTAGCCCATCTC
GCCCTGCCGCATTGTTTCTTCTGCCGCTGCCCATCCCTTGTGCCGCAATGTGCCTTTCTTAAGATTCGTGTGCAC
CTTGCGTCGTATCCGTGTTCGTTCGTGCATGTTAGTACTTAAAGCCTCAGCTGCGAGATGATCCATCTGTGTACA
TAATTCTCCTCTTGTCTCTCCTTTAACCACCTCCCCTGCCGCCTCTCGCTCTTCCTTGCTCTCTTCCTTGCTCTA
TTCCCTCTCTTCCCCCCTTCCCCCCCCCCCTCTCTCTTTCTCACTCTATCGCACATACACACTCACACACATACT
CTCACTCACTCACGCTCACTTCCTCTTGCGAGCCATCACCTTCTTTACCATTTACCAGCCGTCGTCATGAAGCTG
CTGCTGCCTCTCACTCTCCTCGCCACCGTCGCCGGCGTCTCGGCCCAGGAAAAGTGCGATGCCGACTACATCGTA
GAAGCCTGCCTCTCCAGCGAAAGGGCAAAGGTAAACATGATCCTGCCCATCTCACATCCTCTTGCCTCGCTGACT
TGTCTCTCCAGGTCGAGACCTGCCCCCCTACCGACTACGACTGCCTCTGTGCCGCCCACGGGGCCGTGGCCACGT
ACGTCCATCTTATCATGTCCTTTTCTCCCATTAATCTTCTCCCTCCCGCTGACAGTGCCTGAACACAGCTGCTAC
AACAACTGCCCTAACGACCAGCGCGCCCCCTCCGCTCGTCAAGCCGCCCGCAGCAACTGTCAGAACGCCTCCATG
TACGGCACAAAAGCCAAGGCTTCCAAGACGTCTTCCATGTCCGCTTCCTCCACGTCGGACGCCTCTGCCACCACC
ACCGAATCGGACTCTGCTTCTTCCACCAACGGCGTCATGCGCGGCGCTTCTTCTTCCTCGACCAGCACCGCGAGG
CCTACCAGCACCGGTGCCGCTGACGCCTTGTCTGGAAGTACCGGCGGCCTGTTTATGGCCGTCGCTGGTGTCCTG
GCTGCTCTCCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail