Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3917
Gene name
Locationscaffold_306:1694..3505
Strand-
Gene length (bp)1811
Transcript length (bp)1761
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 7.8E-82 70 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F6IBC7|CARD_GIBF5 Beta-apo-4'-carotenal oxygenase OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=carD PE=1 SV=2 61 575 0.0E+00
sp|Q1K615|CARD_NEUCR Beta-apo-4'-carotenal oxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ylo-1 PE=1 SV=1 60 575 0.0E+00
sp|P30838|AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens GN=ALDH3A1 PE=1 SV=3 70 517 5.0E-106
sp|Q1JPA0|AL3B1_BOVIN Aldehyde dehydrogenase family 3 member B1 OS=Bos taurus GN=ALDH3B1 PE=2 SV=1 64 531 8.0E-104
sp|A3RF36|AL3A1_CANLF Aldehyde dehydrogenase, dimeric NADP-preferring OS=Canis lupus familiaris GN=ALDH3A1 PE=2 SV=1 79 517 1.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F6IBC7|CARD_GIBF5 Beta-apo-4'-carotenal oxygenase OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=carD PE=1 SV=2 61 575 0.0E+00
sp|Q1K615|CARD_NEUCR Beta-apo-4'-carotenal oxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ylo-1 PE=1 SV=1 60 575 0.0E+00
sp|P30838|AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens GN=ALDH3A1 PE=1 SV=3 70 517 5.0E-106
sp|Q1JPA0|AL3B1_BOVIN Aldehyde dehydrogenase family 3 member B1 OS=Bos taurus GN=ALDH3B1 PE=2 SV=1 64 531 8.0E-104
sp|A3RF36|AL3A1_CANLF Aldehyde dehydrogenase, dimeric NADP-preferring OS=Canis lupus familiaris GN=ALDH3A1 PE=2 SV=1 79 517 1.0E-103
sp|Q70DU8|AL3H1_ARATH Aldehyde dehydrogenase family 3 member H1 OS=Arabidopsis thaliana GN=ALDH3H1 PE=1 SV=2 79 537 9.0E-103
sp|Q8VXQ2|ALDH_CRAPL Aldehyde dehydrogenase OS=Craterostigma plantagineum GN=ALDH PE=1 SV=1 72 551 3.0E-102
sp|P11883|AL3A1_RAT Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus GN=Aldh3a1 PE=1 SV=3 79 526 6.0E-102
sp|Q8W033|AL3I1_ARATH Aldehyde dehydrogenase family 3 member I1, chloroplastic OS=Arabidopsis thaliana GN=ALDH3I1 PE=1 SV=2 78 519 2.0E-101
sp|Q80VQ0|AL3B1_MOUSE Aldehyde dehydrogenase family 3 member B1 OS=Mus musculus GN=Aldh3b1 PE=1 SV=1 78 531 1.0E-100
sp|Q60HH8|AL3A2_MACFA Fatty aldehyde dehydrogenase OS=Macaca fascicularis GN=ALDH3A2 PE=2 SV=1 78 556 2.0E-99
sp|P51648|AL3A2_HUMAN Fatty aldehyde dehydrogenase OS=Homo sapiens GN=ALDH3A2 PE=1 SV=1 79 538 3.0E-98
sp|Q5RF60|AL3A2_PONAB Fatty aldehyde dehydrogenase OS=Pongo abelii GN=ALDH3A2 PE=2 SV=1 79 538 4.0E-98
sp|Q5XI42|AL3B1_RAT Aldehyde dehydrogenase family 3 member B1 OS=Rattus norvegicus GN=Aldh3b1 PE=2 SV=1 78 531 7.0E-98
sp|P43353|AL3B1_HUMAN Aldehyde dehydrogenase family 3 member B1 OS=Homo sapiens GN=ALDH3B1 PE=1 SV=1 79 524 3.0E-97
sp|P47739|AL3A1_MOUSE Aldehyde dehydrogenase, dimeric NADP-preferring OS=Mus musculus GN=Aldh3a1 PE=1 SV=2 70 526 5.0E-97
sp|Q70E96|AL3F1_ARATH Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana GN=ALDH3F1 PE=2 SV=2 73 527 1.0E-93
sp|P30839|AL3A2_RAT Fatty aldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh3a2 PE=1 SV=1 79 538 5.0E-93
sp|P47740|AL3A2_MOUSE Fatty aldehyde dehydrogenase OS=Mus musculus GN=Aldh3a2 PE=1 SV=2 79 540 1.0E-92
sp|Q54DG1|ALDH3_DICDI Aldehyde dehydrogenase family 3 comG OS=Dictyostelium discoideum GN=comG PE=3 SV=1 80 519 4.0E-91
sp|P39616|ALDH2_BACSU Probable aldehyde dehydrogenase YwdH OS=Bacillus subtilis (strain 168) GN=ywdH PE=3 SV=2 79 530 3.0E-89
sp|Q84DC3|MDLD_PSEPU NAD(P)-dependent benzaldehyde dehydrogenase OS=Pseudomonas putida GN=mdlD PE=1 SV=1 71 504 4.0E-86
sp|Q04458|HFD1_YEAST Fatty aldehyde dehydrogenase HFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFD1 PE=1 SV=1 88 556 7.0E-79
sp|P48448|AL3B2_HUMAN Aldehyde dehydrogenase family 3 member B2 OS=Homo sapiens GN=ALDH3B2 PE=2 SV=3 173 527 2.0E-76
sp|P30840|ALDH1_ENTHI Aldehyde dehydrogenase 1 OS=Entamoeba histolytica GN=ALDH1 PE=3 SV=1 64 520 5.0E-76
sp|Q9A777|CALB_CAUCR Probable coniferyl aldehyde dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=calB PE=3 SV=1 113 502 3.0E-72
sp|P12693|ALDH_PSEOL Aldehyde dehydrogenase OS=Pseudomonas oleovorans GN=alkH PE=2 SV=1 110 500 5.0E-72
sp|Q9I6C8|CALB_PSEAE Probable coniferyl aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=calB PE=3 SV=1 70 518 2.0E-70
sp|P46329|ALDH3_BACSU Probable aldehyde dehydrogenase AldX OS=Bacillus subtilis (strain 168) GN=aldX PE=3 SV=2 72 500 2.0E-68
sp|O86447|CALB_PSEUH Coniferyl aldehyde dehydrogenase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=calB PE=1 SV=3 60 500 9.0E-67
sp|P30907|AL3A1_BOVIN Aldehyde dehydrogenase, dimeric NADP-preferring (Fragment) OS=Bos taurus GN=ALDH3A1 PE=1 SV=2 285 515 2.0E-48
sp|P94428|GABD_BACSU Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Bacillus subtilis (strain 168) GN=gabD PE=1 SV=1 59 487 2.0E-41
sp|O34660|ALDH4_BACSU Putative aldehyde dehydrogenase DhaS OS=Bacillus subtilis (strain 168) GN=dhaS PE=3 SV=1 71 500 2.0E-39
sp|P47895|AL1A3_HUMAN Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens GN=ALDH1A3 PE=1 SV=2 173 500 4.0E-39
sp|P51650|SSDH_RAT Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh5a1 PE=1 SV=2 71 501 8.0E-39
sp|Q0WSF1|AL221_ARATH Aldehyde dehydrogenase 22A1 OS=Arabidopsis thaliana GN=ALDH22A1 PE=2 SV=2 81 506 2.0E-38
sp|P9WNX7|GABD2_MYCTU Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabD2 PE=1 SV=1 95 500 6.0E-38
sp|P9WNX6|GABD2_MYCTO Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabD2 PE=3 SV=1 95 500 6.0E-38
sp|A5U390|GABD2_MYCTA Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gabD2 PE=3 SV=1 95 500 6.0E-38
sp|A1KJE8|GABD2_MYCBP Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gabD2 PE=3 SV=1 95 500 6.0E-38
sp|Q7TZP3|GABD2_MYCBO Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabD2 PE=3 SV=1 95 500 6.0E-38
sp|A0PST9|GABD2_MYCUA Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium ulcerans (strain Agy99) GN=gabD2 PE=3 SV=1 90 500 9.0E-38
sp|Q8BWF0|SSDH_MOUSE Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh5a1 PE=1 SV=1 71 501 1.0E-37
sp|Q8K4D8|AL1A3_RAT Aldehyde dehydrogenase family 1 member A3 OS=Rattus norvegicus GN=Aldh1a3 PE=2 SV=1 173 500 4.0E-37
sp|P94682|TSAD1_COMTE 4-(hydroxymethyl)benzenesulfonate dehydrogenase TsaD1 OS=Comamonas testosteroni GN=tsaD1 PE=1 SV=1 72 494 7.0E-37
sp|Q9AHG1|TSAD2_COMTE Putative 4-(hydroxymethyl)benzenesulfonate dehydrogenase TsaD2 OS=Comamonas testosteroni GN=tsaD2 PE=5 SV=1 72 494 1.0E-36
sp|Q49Z69|ALD1_STAS1 Putative aldehyde dehydrogenase SSP0762 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0762 PE=3 SV=1 173 501 1.0E-36
sp|Q9JHW9|AL1A3_MOUSE Aldehyde dehydrogenase family 1 member A3 OS=Mus musculus GN=Aldh1a3 PE=1 SV=1 173 500 2.0E-36
sp|Q8NVG4|ALD1_STAAW Putative aldehyde dehydrogenase MW2046 OS=Staphylococcus aureus (strain MW2) GN=MW2046 PE=3 SV=1 173 501 4.0E-36
sp|Q6G7I8|ALD1_STAAS Putative aldehyde dehydrogenase SAS2025 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2025 PE=3 SV=1 173 501 4.0E-36
sp|P42757|BADH_ATRHO Betaine aldehyde dehydrogenase, chloroplastic OS=Atriplex hortensis PE=2 SV=1 72 500 5.0E-36
sp|P28237|BADH_BETVU Betaine aldehyde dehydrogenase, chloroplastic OS=Beta vulgaris PE=2 SV=1 94 500 7.0E-36
sp|Q7A4D8|ALD1_STAAN Putative aldehyde dehydrogenase SA1924 OS=Staphylococcus aureus (strain N315) GN=SA1924 PE=1 SV=1 173 501 9.0E-36
sp|Q99SD6|ALD1_STAAM Putative aldehyde dehydrogenase SAV2122 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2122 PE=1 SV=1 173 501 9.0E-36
sp|Q5HE78|ALD1_STAAC Putative aldehyde dehydrogenase SACOL2114 OS=Staphylococcus aureus (strain COL) GN=SACOL2114 PE=3 SV=1 173 501 9.0E-36
sp|Q2FWD6|ALD1_STAA8 Putative aldehyde dehydrogenase SAOUHSC_02363 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02363 PE=3 SV=1 173 501 9.0E-36
sp|Q2FF06|ALD1_STAA3 Putative aldehyde dehydrogenase SAUSA300_2076 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2076 PE=3 SV=1 173 501 9.0E-36
sp|P80668|FEAB_ECOLI Phenylacetaldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=feaB PE=1 SV=2 173 501 1.0E-35
sp|Q6GEV3|ALD1_STAAR Putative aldehyde dehydrogenase SAR2210 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2210 PE=3 SV=1 173 501 1.0E-35
sp|O59808|BADH_SCHPO Probable betaine aldehyde dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu8 PE=2 SV=1 66 497 1.0E-35
sp|Q19A30|AL9A1_ORYLA Aldehyde dehydrogenase family 9 member A1 OS=Oryzias latipes GN=aldh9A1 PE=2 SV=1 173 500 1.0E-35
sp|A0R4Q0|GABD2_MYCS2 Putative succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gabD2 PE=3 SV=1 137 500 2.0E-35
sp|Q4L803|ALD1_STAHJ Putative aldehyde dehydrogenase SH0913 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0913 PE=3 SV=2 72 501 5.0E-35
sp|Q9CZS1|AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus GN=Aldh1b1 PE=1 SV=1 71 505 8.0E-35
sp|Q2YUN1|ALD1_STAAB Putative aldehyde dehydrogenase SAB2006c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2006c PE=3 SV=1 173 501 9.0E-35
sp|Q9S795|BADH1_ARATH Betaine aldehyde dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=ALDH10A8 PE=2 SV=1 95 500 1.0E-34
sp|P17202|BADH_SPIOL Betaine aldehyde dehydrogenase, chloroplastic OS=Spinacia oleracea PE=1 SV=1 72 502 2.0E-34
sp|Q9KWS5|AMNC_PSESP 2-aminomuconic 6-semialdehyde dehydrogenase OS=Pseudomonas sp. GN=amnC PE=1 SV=1 173 501 3.0E-34
sp|Q8CNI5|ALD1_STAES Putative aldehyde dehydrogenase SE_1720 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1720 PE=3 SV=1 72 501 4.0E-34
sp|Q5HMA0|ALD1_STAEQ Putative aldehyde dehydrogenase SERP1729 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1729 PE=3 SV=1 72 501 4.0E-34
sp|Q2XQV4|ALDH2_PIG Aldehyde dehydrogenase, mitochondrial OS=Sus scrofa GN=ALDH2 PE=2 SV=1 72 505 6.0E-34
sp|Q9US47|SSDH1_SCHPO Putative succinate-semialdehyde dehydrogenase C1002.12c [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.12c PE=3 SV=2 61 500 7.0E-34
sp|Q7ZVB2|A9A1A_DANRE Aldehyde dehydrogenase family 9 member A1-A OS=Danio rerio GN=aldh9a1a PE=2 SV=1 173 500 1.0E-33
sp|Q9SU63|AL2B4_ARATH Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B4 PE=2 SV=1 173 506 1.0E-33
sp|Q5RF00|ALDH2_PONAB Aldehyde dehydrogenase, mitochondrial OS=Pongo abelii GN=ALDH2 PE=2 SV=1 72 505 2.0E-33
sp|Q0P5F9|AL8A1_BOVIN Aldehyde dehydrogenase family 8 member A1 OS=Bos taurus GN=ALDH8A1 PE=2 SV=1 174 500 2.0E-33
sp|P05091|ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH2 PE=1 SV=2 72 505 3.0E-33
sp|O04895|BADH_AMAHP Betaine aldehyde dehydrogenase, chloroplastic OS=Amaranthus hypochondriacus GN=BADH4 PE=3 SV=1 137 500 5.0E-33
sp|Q58806|LADH_METJA Lactaldehyde dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1411 PE=1 SV=2 165 500 6.0E-33
sp|A6VH72|LADH_METM7 Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0731 PE=3 SV=1 173 501 7.0E-33
sp|P20000|ALDH2_BOVIN Aldehyde dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH2 PE=1 SV=2 71 505 7.0E-33
sp|Q5R6B5|AL1B1_PONAB Aldehyde dehydrogenase X, mitochondrial OS=Pongo abelii GN=ALDH1B1 PE=2 SV=1 71 505 7.0E-33
sp|P11884|ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh2 PE=1 SV=1 173 505 7.0E-33
sp|P81178|ALDH2_MESAU Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=ALDH2 PE=1 SV=1 173 505 1.0E-32
sp|P47738|ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh2 PE=1 SV=1 173 505 1.0E-32
sp|Q8S528|AL2B7_ARATH Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2 165 506 1.0E-32
sp|Q63639|AL1A2_RAT Retinal dehydrogenase 2 OS=Rattus norvegicus GN=Aldh1a2 PE=1 SV=2 173 505 1.0E-32
sp|Q66HF8|AL1B1_RAT Aldehyde dehydrogenase X, mitochondrial OS=Rattus norvegicus GN=Aldh1b1 PE=1 SV=1 71 500 1.0E-32
sp|P30837|AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens GN=ALDH1B1 PE=1 SV=3 71 505 1.0E-32
sp|O69763|VDH_PSEFL Vanillin dehydrogenase OS=Pseudomonas fluorescens GN=vdh PE=3 SV=1 173 498 1.0E-32
sp|P71016|BETB_BACSU Betaine aldehyde dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsA PE=1 SV=1 120 502 2.0E-32
sp|Q62148|AL1A2_MOUSE Retinal dehydrogenase 2 OS=Mus musculus GN=Aldh1a2 PE=1 SV=2 173 505 3.0E-32
sp|Q8BH00|AL8A1_MOUSE Aldehyde dehydrogenase family 8 member A1 OS=Mus musculus GN=Aldh8a1 PE=1 SV=1 174 500 3.0E-32
sp|A6UVT6|LADH_META3 Lactaldehyde dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_1030 PE=3 SV=1 173 500 3.0E-32
sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA2 PE=1 SV=2 69 500 3.0E-32
sp|O94788|AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens GN=ALDH1A2 PE=1 SV=3 173 505 5.0E-32
sp|P27463|AL1A1_CHICK Retinal dehydrogenase 1 OS=Gallus gallus GN=ALDH1A1 PE=2 SV=1 71 505 5.0E-32
sp|Q9JLJ3|AL9A1_RAT 4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh9a1 PE=1 SV=1 173 501 5.0E-32
sp|A4FW36|LADH_METM5 Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0090 PE=3 SV=1 173 501 5.0E-32
sp|Q6FDF8|BETB_ACIAD NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=betB PE=3 SV=1 173 500 5.0E-32
sp|Q802W2|A9A1B_DANRE Aldehyde dehydrogenase family 9 member A1-B OS=Danio rerio GN=aldh9a1b PE=2 SV=2 173 500 6.0E-32
sp|Q4A0E7|ROCA_STAS1 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocA PE=3 SV=1 138 481 6.0E-32
sp|P12762|ALDH2_HORSE Aldehyde dehydrogenase, mitochondrial OS=Equus caballus GN=ALDH2 PE=1 SV=1 173 505 6.0E-32
sp|Q3MSM4|SSDH_PANPA Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan paniscus GN=ALDH5A1 PE=2 SV=1 161 501 7.0E-32
sp|Q5R8A4|AL9A1_PONAB 4-trimethylaminobutyraldehyde dehydrogenase OS=Pongo abelii GN=ALDH9A1 PE=2 SV=2 173 501 7.0E-32
sp|Q6A2H1|SSDH_GORGO Succinate-semialdehyde dehydrogenase, mitochondrial OS=Gorilla gorilla gorilla GN=ALDH5A1 PE=2 SV=1 161 501 8.0E-32
sp|P49189|AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens GN=ALDH9A1 PE=1 SV=3 173 501 1.0E-31
sp|Q3MSM3|SSDH_HYLLA Succinate-semialdehyde dehydrogenase, mitochondrial OS=Hylobates lar GN=ALDH5A1 PE=2 SV=1 84 501 1.0E-31
sp|Q84LK3|BADH2_ORYSJ Betaine aldehyde dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=BADH2 PE=1 SV=1 95 487 1.0E-31
sp|B3VMC0|BADH2_ORYSI Betaine aldehyde dehydrogenase 2 OS=Oryza sativa subsp. indica GN=BADH2 PE=2 SV=1 95 487 1.0E-31
sp|Q2KJH9|AL9A1_BOVIN 4-trimethylaminobutyraldehyde dehydrogenase OS=Bos taurus GN=ALDH9A1 PE=2 SV=1 173 501 1.0E-31
sp|O06837|STYD_PSEFL Phenylacetaldehyde dehydrogenase OS=Pseudomonas fluorescens GN=styD PE=1 SV=1 70 500 1.0E-31
sp|Q9H2A2|AL8A1_HUMAN Aldehyde dehydrogenase family 8 member A1 OS=Homo sapiens GN=ALDH8A1 PE=1 SV=1 72 500 1.0E-31
sp|Q6A2H0|SSDH_PANTR Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan troglodytes GN=ALDH5A1 PE=2 SV=1 161 501 2.0E-31
sp|B9F3B6|SSDH_ORYSJ Succinate-semialdehyde dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=ALDH5F1 PE=3 SV=1 173 501 2.0E-31
sp|P19059|DMPC_PSEUF 2-hydroxymuconic semialdehyde dehydrogenase OS=Pseudomonas sp. (strain CF600) GN=dmpC PE=3 SV=1 174 501 2.0E-31
sp|P51649|SSDH_HUMAN Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH5A1 PE=1 SV=2 173 501 3.0E-31
sp|O93344|AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus GN=ALDH1A2 PE=2 SV=2 173 505 3.0E-31
sp|Q6A2H2|SSDH_PONPY Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pongo pygmaeus GN=ALDH5A1 PE=2 SV=2 84 501 3.0E-31
sp|Q9SAK4|SSDH_ARATH Succinate-semialdehyde dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=ALDH5F1 PE=1 SV=2 173 501 5.0E-31
sp|P23105|XYLG_PSEPU 2-hydroxymuconic semialdehyde dehydrogenase OS=Pseudomonas putida GN=xylG PE=1 SV=1 174 501 5.0E-31
sp|P32872|ALDHY_YEASX Aldehyde dehydrogenase 2, mitochondrial OS=Saccharomyces cerevisiae GN=ALD2 PE=3 SV=1 171 492 5.0E-31
sp|Q6GCV9|ALDA_STAAS Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MSSA476) GN=aldA PE=3 SV=1 170 490 1.0E-30
sp|F8JX40|FLUDE_STREN Fluoroacetaldehyde dehydrogenase OS=Streptomyces cattleya (strain ATCC 35852 / DSM 46488 / JCM 4925 / NBRC 14057 / NRRL 8057) GN=SCAT_0945 PE=1 SV=1 173 483 1.0E-30
sp|Q9I8W8|AL1A2_TAEGU Retinal dehydrogenase 2 OS=Taeniopygia guttata GN=ALDH1A2 PE=2 SV=1 173 505 1.0E-30
sp|Q7A1Y7|ALDA_STAAW Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MW2) GN=aldA PE=3 SV=1 170 490 1.0E-30
sp|Q7A825|ALDA_STAAN Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain N315) GN=aldA PE=1 SV=1 170 490 1.0E-30
sp|Q99X54|ALDA_STAAM Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=aldA PE=3 SV=1 170 490 1.0E-30
sp|Q5HJK3|ALDA_STAAC Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain COL) GN=aldA PE=3 SV=1 170 490 1.0E-30
sp|Q2G1J0|ALDA_STAA8 Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain NCTC 8325) GN=aldA PE=3 SV=1 170 490 1.0E-30
sp|Q2FK94|ALDA_STAA3 Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain USA300) GN=aldA PE=3 SV=1 170 490 1.0E-30
sp|Q2YV11|ALDA_STAAB Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=aldA PE=3 SV=1 170 490 2.0E-30
sp|O24174|BADH1_ORYSJ Betaine aldehyde dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=BADH1 PE=1 SV=1 112 505 2.0E-30
sp|Q6GKD8|ALDA_STAAR Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MRSA252) GN=aldA PE=3 SV=1 170 490 2.0E-30
sp|Q27640|ALDH_ENCBU Aldehyde dehydrogenase OS=Enchytraeus buchholzi GN=ALDH PE=2 SV=1 173 500 2.0E-30
sp|Q0TKW0|BETB_ECOL5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betB PE=3 SV=1 173 500 3.0E-30
sp|Q9JLJ2|AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus GN=Aldh9a1 PE=1 SV=1 173 501 4.0E-30
sp|P08157|ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aldA PE=3 SV=2 113 500 5.0E-30
sp|P15437|AL1A1_HORSE Retinal dehydrogenase 1 OS=Equus caballus GN=ALDH1A1 PE=1 SV=1 173 500 7.0E-30
sp|P51977|AL1A1_SHEEP Retinal dehydrogenase 1 OS=Ovis aries GN=ALDH1A1 PE=1 SV=2 173 500 7.0E-30
sp|P24549|AL1A1_MOUSE Retinal dehydrogenase 1 OS=Mus musculus GN=Aldh1a1 PE=1 SV=5 71 500 8.0E-30
sp|H8ZPX2|SAPD_PSESP 3-succinoylsemialdehyde-pyridine dehydrogenase OS=Pseudomonas sp. GN=ald PE=1 SV=1 85 500 8.0E-30
sp|Q9I6M5|DAVD_PSEAE Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davD PE=1 SV=1 173 501 8.0E-30
sp|A3PI00|BETB_RHOS1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=betB PE=3 SV=1 112 500 8.0E-30
sp|P51647|AL1A1_RAT Retinal dehydrogenase 1 OS=Rattus norvegicus GN=Aldh1a1 PE=1 SV=3 71 500 9.0E-30
sp|B9KNS6|BETB_RHOSK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=betB PE=3 SV=1 112 500 9.0E-30
sp|P48644|AL1A1_BOVIN Retinal dehydrogenase 1 OS=Bos taurus GN=ALDH1A1 PE=2 SV=3 173 500 9.0E-30
sp|Q3J4E9|BETB_RHOS4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=betB PE=3 SV=1 112 500 1.0E-29
sp|Q8ERF4|ROCA_OCEIH 1-pyrroline-5-carboxylate dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rocA PE=3 SV=1 73 487 2.0E-29
sp|Q9URW9|YLX7_SCHPO Putative aldehyde dehydrogenase-like protein C922.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.07c PE=3 SV=1 174 500 2.0E-29
sp|H1ZV37|GEOB_CASDE Geranial dehydrogenase OS=Castellaniella defragrans GN=geoB PE=1 SV=1 170 500 3.0E-29
sp|Q8HYE4|AL1A1_MACFA Retinal dehydrogenase 1 OS=Macaca fascicularis GN=ALDH1A1 PE=2 SV=3 71 500 3.0E-29
sp|Q25417|ALDH2_LEITA Aldehyde dehydrogenase, mitochondrial OS=Leishmania tarentolae GN=ALDH2 PE=1 SV=1 62 500 3.0E-29
sp|Q28399|ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii GN=ALDH1 PE=1 SV=1 72 500 4.0E-29
sp|O05619|VDH_PSEUH Vanillin dehydrogenase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=vdh PE=1 SV=1 173 498 4.0E-29
sp|Q8NUR2|ROCA_STAAW 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=rocA PE=3 SV=1 172 481 5.0E-29
sp|Q9STS1|BADH2_ARATH Betaine aldehyde dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=ALDH10A9 PE=2 SV=1 120 500 6.0E-29
sp|A8Z3F5|ROCA_STAAT 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|Q6GDP4|ROCA_STAAR 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|P99076|ROCA_STAAN 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=rocA PE=1 SV=1 172 481 6.0E-29
sp|P63939|ROCA_STAAM 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|A6QK44|ROCA_STAAE 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain Newman) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|Q5HCZ6|ROCA_STAAC 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|Q2YWA6|ROCA_STAAB 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|A5IVY0|ROCA_STAA9 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain JH9) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|Q2FV67|ROCA_STAA8 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|Q2FDV3|ROCA_STAA3 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|A6U4T5|ROCA_STAA2 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain JH1) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|A7X6R7|ROCA_STAA1 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rocA PE=3 SV=1 172 481 6.0E-29
sp|A3M365|BETB_ACIBT NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=betB PE=3 SV=2 173 500 6.0E-29
sp|Q8MI17|AL1A1_RABIT Retinal dehydrogenase 1 OS=Oryctolagus cuniculus GN=ALDH1A1 PE=2 SV=1 173 500 7.0E-29
sp|Q8CN04|ROCA_STAES 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rocA PE=3 SV=1 138 481 8.0E-29
sp|Q5HL59|ROCA_STAEQ 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rocA PE=3 SV=1 138 481 8.0E-29
sp|O06478|ALDH5_BACSU Putative aldehyde dehydrogenase YfmT OS=Bacillus subtilis (strain 168) GN=yfmT PE=2 SV=1 174 518 8.0E-29
sp|Q88RC0|DAVD_PSEPK Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas putida (strain KT2440) GN=davD PE=3 SV=1 173 501 1.0E-28
sp|B0VST2|BETB_ACIBS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=betB PE=3 SV=1 173 500 1.0E-28
sp|P00352|AL1A1_HUMAN Retinal dehydrogenase 1 OS=Homo sapiens GN=ALDH1A1 PE=1 SV=2 173 500 1.0E-28
sp|Q6LX65|LADH_METMP Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1487 PE=3 SV=1 173 501 1.0E-28
sp|A6UQD0|LADH_METVS Lactaldehyde dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0796 PE=3 SV=1 173 501 1.0E-28
sp|B0V944|BETB_ACIBY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=betB PE=3 SV=1 173 500 1.0E-28
sp|B7I896|BETB_ACIB5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=betB PE=3 SV=1 173 500 1.0E-28
sp|B7GYG4|BETB_ACIB3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=betB PE=3 SV=1 173 500 1.0E-28
sp|Q40024|BADH_HORVU Betaine aldehyde dehydrogenase OS=Hordeum vulgare PE=2 SV=1 173 502 2.0E-28
sp|P54115|ALDH6_YEAST Magnesium-activated aldehyde dehydrogenase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD6 PE=1 SV=4 172 500 2.0E-28
sp|Q63KK8|BETB_BURPS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=betB PE=3 SV=1 74 500 2.0E-28
sp|A8F9T1|ROCA_BACP2 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus pumilus (strain SAFR-032) GN=rocA PE=3 SV=1 84 487 2.0E-28
sp|P56533|BADH_GADMC Betaine aldehyde dehydrogenase OS=Gadus morhua subsp. callarias GN=aldh9A1 PE=1 SV=1 173 500 2.0E-28
sp|B2HV80|BETB_ACIBC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=betB PE=3 SV=1 173 500 2.0E-28
sp|P52476|AL1B1_BOVIN Aldehyde dehydrogenase X, mitochondrial (Fragment) OS=Bos taurus GN=ALDH1B1 PE=2 SV=2 120 505 2.0E-28
sp|P25795|AL7A1_PEA Aldehyde dehydrogenase family 7 member A1 OS=Pisum sativum PE=1 SV=3 72 503 2.0E-28
sp|Q29490|ALDH1_MACPR Aldehyde dehydrogenase, cytosolic 1 OS=Macroscelides proboscideus GN=ALDH1 PE=2 SV=1 72 500 3.0E-28
sp|O74187|ALDH_AGABI Aldehyde dehydrogenase OS=Agaricus bisporus GN=aldA PE=3 SV=1 173 506 3.0E-28
sp|P43503|XYLC_PSEPU Benzaldehyde dehydrogenase [NAD(+)] OS=Pseudomonas putida GN=xylC PE=1 SV=1 171 429 3.0E-28
sp|P25553|ALDA_ECOLI Lactaldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=aldA PE=1 SV=2 95 491 3.0E-28
sp|Q4L966|ROCA_STAHJ 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rocA PE=3 SV=1 138 481 3.0E-28
sp|Q66I21|AL8A1_DANRE Aldehyde dehydrogenase family 8 member A1 OS=Danio rerio GN=aldh8a1 PE=2 SV=1 174 500 5.0E-28
sp|Q9ZPB7|AL7A1_MALDO Aldehyde dehydrogenase family 7 member A1 OS=Malus domestica PE=1 SV=3 78 503 5.0E-28
sp|Q13NG6|BETB_BURXL NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=betB PE=3 SV=1 71 500 5.0E-28
sp|P46367|ALDH4_YEAST Potassium-activated aldehyde dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD4 PE=1 SV=2 173 483 6.0E-28
sp|P76149|SAD_ECOLI Succinate semialdehyde dehydrogenase [NAD(P)+] Sad OS=Escherichia coli (strain K12) GN=sad PE=1 SV=2 60 510 6.0E-28
sp|Q9ZA11|ALDH_RHORT Aldehyde dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A0931 PE=3 SV=2 173 486 6.0E-28
sp|A6X2G8|BETB_OCHA4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=betB PE=3 SV=1 173 500 6.0E-28
sp|Q9HTJ1|BETB_PSEAE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=betB PE=1 SV=1 173 500 7.0E-28
sp|B7V5R4|BETB_PSEA8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=betB PE=3 SV=1 173 500 7.0E-28
sp|A6VEI4|BETB_PSEA7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betB PE=3 SV=1 173 500 7.0E-28
sp|P40108|ALDH_DAVTA Aldehyde dehydrogenase OS=Davidiella tassiana GN=CLAH10 PE=1 SV=2 170 500 8.0E-28
sp|P86886|AL1A1_MESAU Retinal dehydrogenase 1 OS=Mesocricetus auratus GN=ALDH1A1 PE=1 SV=1 173 500 8.0E-28
sp|P46562|AL7A1_CAEEL Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Caenorhabditis elegans GN=alh-9 PE=3 SV=2 58 503 8.0E-28
sp|Q9HK01|GADH_THEAC D-glyceraldehyde dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0809 PE=1 SV=1 95 443 9.0E-28
sp|P40047|ALDH5_YEAST Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD5 PE=1 SV=4 173 500 9.0E-28
sp|A6ZR27|ALDH5_YEAS7 Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ALD5 PE=3 SV=1 173 500 9.0E-28
sp|O14293|YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.09c PE=1 SV=1 171 500 1.0E-27
sp|Q87H52|BETB_VIBPA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=betB PE=3 SV=1 173 500 1.0E-27
sp|A9VRG6|ROCA_BACWK 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus weihenstephanensis (strain KBAB4) GN=rocA PE=3 SV=1 82 487 1.0E-27
sp|Q6G6C0|ROCA_STAAS 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=rocA PE=3 SV=1 172 481 1.0E-27
sp|P13601|AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus GN=Aldh1a7 PE=1 SV=2 173 500 1.0E-27
sp|A1UVS4|BETB_BURMS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=betB PE=3 SV=1 74 500 1.0E-27
sp|Q62CH7|BETB_BURMA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=betB PE=3 SV=1 74 500 1.0E-27
sp|A2RWD6|BETB_BURM9 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=betB PE=3 SV=1 74 500 1.0E-27
sp|A3MEC6|BETB_BURM7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=betB PE=3 SV=1 74 500 1.0E-27
sp|P41751|ALDH_ASPNG Aldehyde dehydrogenase OS=Aspergillus niger GN=aldA PE=3 SV=1 173 500 2.0E-27
sp|A3NKP8|BETB_BURP6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=betB PE=3 SV=1 74 500 2.0E-27
sp|Q02DY9|BETB_PSEAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betB PE=3 SV=1 173 500 2.0E-27
sp|B2TCJ9|BETB_BURPP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=betB PE=3 SV=1 95 500 3.0E-27
sp|A6W2P7|BETB_MARMS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=betB PE=3 SV=1 173 500 3.0E-27
sp|A7GKJ4|ROCA_BACCN 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rocA PE=3 SV=1 82 487 3.0E-27
sp|Q6L285|GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0332 PE=1 SV=1 65 443 3.0E-27
sp|Q3JLL8|BETB_BURP1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=betB PE=3 SV=1 74 500 3.0E-27
sp|A3P6B0|BETB_BURP0 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=betB PE=3 SV=1 74 500 3.0E-27
sp|B7UJG5|BETB_ECO27 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=betB PE=3 SV=1 173 500 3.0E-27
sp|Q0B712|BETB_BURCM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=betB PE=3 SV=1 173 500 4.0E-27
sp|B1Z033|BETB_BURA4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=betB PE=3 SV=1 173 500 5.0E-27
sp|Q8FKI8|BETB_ECOL6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=betB PE=3 SV=3 173 500 5.0E-27
sp|B7MCD1|BETB_ECO45 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=betB PE=3 SV=1 173 500 5.0E-27
sp|A4WUY6|BETB_RHOS5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=betB PE=3 SV=1 120 500 5.0E-27
sp|P62028|ROCA_BACC1 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rocA PE=3 SV=1 82 487 6.0E-27
sp|Q65NN2|ROCA_BACLD 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rocA PE=1 SV=1 117 487 7.0E-27
sp|P30841|CROM_ENTDO Omega-crystallin OS=Enteroctopus dofleini PE=1 SV=3 171 500 7.0E-27
sp|P23883|PUUC_ECOLI Aldehyde dehydrogenase PuuC OS=Escherichia coli (strain K12) GN=puuC PE=1 SV=2 173 500 7.0E-27
sp|P94391|ROCA2_BACSU 1-pyrroline-5-carboxylate dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=putC PE=2 SV=2 131 487 8.0E-27
sp|P55653|GABD_RHISN Probable succinate-semialdehyde dehydrogenase [NADP(+)] OS=Rhizobium sp. (strain NGR234) GN=gabD PE=3 SV=1 173 501 8.0E-27
sp|E1V7V8|DOEC_HALED Aspartate-semialdehyde dehydrogenase (Non-phosphorylating) OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=doeC PE=3 SV=1 173 501 1.0E-26
sp|Q81IP0|ROCA_BACCR 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|B7H4V1|ROCA_BACC4 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain B4264) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|B7IUW8|ROCA_BACC2 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain G9842) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|P17445|BETB_ECOLI NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=betB PE=1 SV=3 173 500 1.0E-26
sp|B1XET7|BETB_ECODH NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betB PE=3 SV=1 173 500 1.0E-26
sp|B7NK50|BETB_ECO7I NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=betB PE=3 SV=1 171 500 1.0E-26
sp|P0A390|NAHF_PSEU8 Salicylaldehyde dehydrogenase OS=Pseudomonas sp. (strain C18) GN=doxF PE=3 SV=1 66 498 1.0E-26
sp|P0A391|NAHF_PSEPU Salicylaldehyde dehydrogenase OS=Pseudomonas putida GN=nahF PE=3 SV=1 66 498 1.0E-26
sp|Q9RJZ6|ALDH_STRCO Probable aldehyde dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1174 PE=3 SV=1 173 500 1.0E-26
sp|Q6HP91|ROCA_BACHK 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|Q63GS0|ROCA_BACCZ 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|B9J1L9|ROCA_BACCQ 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain Q1) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|B7HSW8|ROCA_BACC7 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain AH187) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|C1EV77|ROCA_BACC3 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain 03BB102) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|B7JM99|ROCA_BACC0 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain AH820) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|Q81ZF8|ROCA_BACAN 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus anthracis GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|A0R909|ROCA_BACAH 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus thuringiensis (strain Al Hakam) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|C3L546|ROCA_BACAC 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|C3PBP4|ROCA_BACAA 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus anthracis (strain A0248) GN=rocA PE=3 SV=1 82 487 1.0E-26
sp|Q1JUP4|KGSDH_AZOBR Alpha-ketoglutaric semialdehyde dehydrogenase OS=Azospirillum brasilense GN=araE PE=1 SV=1 81 501 1.0E-26
sp|C0RHQ3|BETB_BRUMB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=betB PE=3 SV=1 173 500 1.0E-26
sp|Q41247|AL7A1_BRANA Aldehyde dehydrogenase family 7 member A1 OS=Brassica napus GN=BTG-26 PE=1 SV=3 117 499 1.0E-26
sp|P25526|GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP(+)] GabD OS=Escherichia coli (strain K12) GN=gabD PE=1 SV=1 173 501 2.0E-26
sp|A4XPI6|BETB_PSEMY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|Q8G1Z9|BETB_BRUSU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|A9M9H7|BETB_BRUC2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|B0CKN3|BETB_BRUSI NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|Q9UTM8|SSDH2_SCHPO Putative succinate-semialdehyde dehydrogenase C139.05 [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.05 PE=3 SV=1 62 500 2.0E-26
sp|A5VPA5|BETB_BRUO2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|Q8YFY0|BETB_BRUME NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betB PE=3 SV=2 173 500 2.0E-26
sp|Q57EI0|BETB_BRUAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|Q2YMP8|BETB_BRUA2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus (strain 2308) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|B2SA42|BETB_BRUA1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus (strain S19) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|P46368|DHA2_CUPNH Acetaldehyde dehydrogenase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acoD PE=1 SV=1 173 483 2.0E-26
sp|B7L441|BETB_ECO55 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=betB PE=3 SV=1 173 500 2.0E-26
sp|P42329|ALDH_GEOSE Aldehyde dehydrogenase, thermostable OS=Geobacillus stearothermophilus GN=aldHT PE=1 SV=1 85 500 3.0E-26
sp|A7ZWV5|BETB_ECOHS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betB PE=3 SV=1 173 500 3.0E-26
sp|Q9SYG7|AL7B4_ARATH Aldehyde dehydrogenase family 7 member B4 OS=Arabidopsis thaliana GN=ALDH7B4 PE=2 SV=3 117 503 4.0E-26
sp|B1J0W5|BETB_ECOLC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betB PE=3 SV=1 173 500 5.0E-26
sp|C3K3D2|BETB_PSEFS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=betB PE=3 SV=1 173 500 7.0E-26
sp|Q0T7M9|BETB_SHIF8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betB PE=3 SV=1 173 500 7.0E-26
sp|B7N8L4|BETB_ECOLU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betB PE=3 SV=1 173 500 8.0E-26
sp|A7ZI51|BETB_ECO24 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=betB PE=3 SV=1 173 500 9.0E-26
sp|B7M2V6|BETB_ECO8A NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=betB PE=3 SV=1 173 500 1.0E-25
sp|B6I075|BETB_ECOSE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=betB PE=3 SV=1 173 500 1.0E-25
sp|C6DKY5|BETB_PECCP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=betB PE=3 SV=1 173 500 1.0E-25
sp|Q56YU0|AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana GN=ALDH2C4 PE=1 SV=2 173 429 1.0E-25
sp|Q5L3K8|ROCA_GEOKA 1-pyrroline-5-carboxylate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=rocA PE=3 SV=1 132 487 2.0E-25
sp|B5Z1R1|BETB_ECO5E NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=betB PE=3 SV=1 173 500 2.0E-25
sp|Q7AH91|BETB_ECO57 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O157:H7 GN=betB PE=3 SV=3 173 500 2.0E-25
sp|O35945|AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus GN=Aldh1a7 PE=1 SV=1 71 500 2.0E-25
sp|Q8D3K3|BETB_VIBVU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betB PE=3 SV=1 95 500 2.0E-25
sp|C5D4J5|ROCA_GEOSW 1-pyrroline-5-carboxylate dehydrogenase OS=Geobacillus sp. (strain WCH70) GN=rocA PE=3 SV=1 131 487 2.0E-25
sp|Q73TP5|GABD1_MYCPA Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gabD1 PE=3 SV=1 109 500 2.0E-25
sp|P9WNY1|ALDH_MYCTU Probable aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0458 PE=1 SV=1 173 511 2.0E-25
sp|P9WNY0|ALDH_MYCTO Probable aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0474 PE=3 SV=1 173 511 2.0E-25
sp|P63938|ALDH_MYCBO Probable aldehyde dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0467 PE=3 SV=1 173 511 2.0E-25
sp|B1LIJ8|BETB_ECOSM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betB PE=3 SV=1 173 500 3.0E-25
sp|A0QMB9|GABD1_MYCA1 Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium avium (strain 104) GN=gabD1 PE=3 SV=1 109 500 4.0E-25
sp|Q9K5Z5|ROCA2_BACHD 1-pyrroline-5-carboxylate dehydrogenase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocA2 PE=3 SV=1 37 487 4.0E-25
sp|Q8CN24|ALDA_STAES Putative aldehyde dehydrogenase AldA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=aldA PE=3 SV=1 73 500 4.0E-25
sp|Q5HLA3|ALDA_STAEQ Putative aldehyde dehydrogenase AldA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=aldA PE=3 SV=1 73 500 4.0E-25
sp|A7N2Q0|BETB_VIBCB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betB PE=3 SV=1 72 500 5.0E-25
sp|P9WNX9|GABD1_MYCTU Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabD1 PE=1 SV=1 147 500 6.0E-25
sp|P9WNX8|GABD1_MYCTO Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabD1 PE=3 SV=1 147 500 6.0E-25
sp|A5TYV9|GABD1_MYCTA Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gabD1 PE=3 SV=2 147 500 6.0E-25
sp|A1KF54|GABD1_MYCBP Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gabD1 PE=3 SV=2 147 500 6.0E-25
sp|Q7U2I0|GABD1_MYCBO Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabD1 PE=3 SV=2 147 500 6.0E-25
sp|P39634|ROCA_BACSU 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus subtilis (strain 168) GN=rocA PE=2 SV=1 131 487 6.0E-25
sp|Q97UA1|KGSDH_SULSO 2,5-dioxopentanoate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aldhT PE=1 SV=1 173 481 7.0E-25
sp|Q9RYG9|ALDH_DEIRA Aldehyde dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aldA PE=3 SV=1 173 483 8.0E-25
sp|Q2BN77|SAFD_NEPCE Sulfoacetaldehyde dehydrogenase OS=Neptuniibacter caesariensis GN=safD PE=1 SV=1 128 500 8.0E-25
sp|B7GFV3|ROCA_ANOFW 1-pyrroline-5-carboxylate dehydrogenase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rocA PE=3 SV=1 131 487 8.0E-25
sp|B7VQ28|BETB_VIBTL NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=betB PE=3 SV=1 173 500 1.0E-24
sp|B1J2K9|BETB_PSEPW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain W619) GN=betB PE=3 SV=1 173 500 1.0E-24
sp|B1JSQ9|BETB_YERPY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=betB PE=3 SV=1 173 500 1.0E-24
sp|P94358|ALDY_BACSU Uncharacterized aldehyde dehydrogenase AldY OS=Bacillus subtilis (strain 168) GN=aldY PE=1 SV=1 174 518 1.0E-24
sp|O69497|GABD1_MYCLE Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium leprae (strain TN) GN=gabD1 PE=3 SV=1 171 500 2.0E-24
sp|Q7MF13|BETB_VIBVY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betB PE=3 SV=1 95 500 2.0E-24
sp|Q1IG69|BETB_PSEE4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betB PE=3 SV=1 173 500 2.0E-24
sp|Q4K4K8|BETB_PSEF5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=betB PE=3 SV=1 173 500 2.0E-24
sp|A4IJP9|ROCA_GEOTN 1-pyrroline-5-carboxylate dehydrogenase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rocA PE=3 SV=1 132 487 2.0E-24
sp|P42041|ALDH_ALTAL Aldehyde dehydrogenase OS=Alternaria alternata GN=ALTA10 PE=1 SV=2 170 500 2.0E-24
sp|P37685|ALDB_ECOLI Aldehyde dehydrogenase B OS=Escherichia coli (strain K12) GN=aldB PE=1 SV=2 173 511 3.0E-24
sp|P0C6D7|ALDH_VIBCH Aldehyde dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aldA PE=3 SV=1 173 500 3.0E-24
sp|A5F3A7|ALDH_VIBC3 Aldehyde dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aldA PE=3 SV=2 173 500 3.0E-24
sp|A0B2F6|BETB_BURCH NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=betB PE=3 SV=1 95 500 3.0E-24
sp|Q1BQE1|BETB_BURCA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=betB PE=3 SV=1 95 500 3.0E-24
sp|D4GP41|KGSDH_HALVD Alpha-ketoglutarate semialdehyde dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_B0039 PE=1 SV=1 173 476 4.0E-24
sp|Q88CW7|BETB_PSEPK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betB PE=3 SV=1 173 500 5.0E-24
sp|A5WA96|BETB_PSEP1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betB PE=3 SV=1 173 500 5.0E-24
sp|Q9K9B2|ROCA1_BACHD 1-pyrroline-5-carboxylate dehydrogenase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocA1 PE=1 SV=1 126 487 5.0E-24
sp|A8H8E0|ASTD_SHEPA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=astD PE=3 SV=1 170 490 5.0E-24
sp|B1K708|BETB_BURCC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=betB PE=3 SV=1 95 500 5.0E-24
sp|Q3K5H4|BETB_PSEPF NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=betB PE=3 SV=1 173 500 7.0E-24
sp|A9AN00|BETB_BURM1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=betB PE=3 SV=1 173 500 8.0E-24
sp|Q9FDS1|ALD1_ACISP Long-chain-aldehyde dehydrogenase OS=Acinetobacter sp. GN=ald1 PE=1 SV=1 173 483 8.0E-24
sp|A4VKC2|BETB_PSEU5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=betB PE=3 SV=1 173 500 9.0E-24
sp|Q39A43|BETB_BURL3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=betB PE=3 SV=1 173 500 1.0E-23
sp|B4SHW0|BETB_STRM5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=betB PE=3 SV=1 173 500 1.0E-23
sp|P46369|THCA_RHOER EPTC-inducible aldehyde dehydrogenase OS=Rhodococcus erythropolis GN=thcA PE=1 SV=2 173 483 1.0E-23
sp|B2FQ90|BETB_STRMK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=betB PE=3 SV=1 173 500 1.0E-23
sp|B2JS88|BETB_BURP8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betB PE=3 SV=1 71 500 1.0E-23
sp|B0KN18|BETB_PSEPG NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betB PE=3 SV=1 173 500 1.0E-23
sp|Q8GAK7|ALDH_ARTNI Aldehyde dehydrogenase OS=Arthrobacter nicotinovorans GN=aldh PE=1 SV=1 60 500 2.0E-23
sp|O57693|GAPN_THETE NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Thermoproteus tenax GN=gapN PE=1 SV=1 170 501 2.0E-23
sp|Q53197|Y4UC_RHISN Putative aldehyde-dehydrogenase-like protein y4uC OS=Rhizobium sp. (strain NGR234) GN=NGR_a01370 PE=3 SV=1 75 501 2.0E-23
sp|B4EHJ1|BETB_BURCJ NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=betB PE=3 SV=1 95 500 2.0E-23
sp|C6DD82|ABDH_PECCP Gamma-aminobutyraldehyde dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=prr PE=3 SV=1 170 500 2.0E-23
sp|B0TU38|ASTD_SHEHH N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=astD PE=3 SV=1 170 490 3.0E-23
sp|P54114|ALDH3_YEAST Aldehyde dehydrogenase [NAD(P)+] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD3 PE=1 SV=1 59 500 3.0E-23
sp|Q985M6|BETB_RHILO NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betB PE=3 SV=1 173 500 3.0E-23
sp|A8GBX8|BETB_SERP5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=betB PE=3 SV=1 173 500 3.0E-23
sp|P30842|CROM_NOTSL Omega-crystallin OS=Nototodarus sloanii PE=2 SV=3 173 500 4.0E-23
sp|Q92YD2|BETB2_RHIME NAD/NADP-dependent betaine aldehyde dehydrogenase 2 OS=Rhizobium meliloti (strain 1021) GN=betB2 PE=3 SV=2 173 500 4.0E-23
sp|B9JBA3|BETB_AGRRK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betB PE=3 SV=1 155 500 5.0E-23
sp|A4Y344|ASTD_SHEPC N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=astD PE=3 SV=1 170 490 5.0E-23
sp|A7FKL5|BETB_YERP3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=betB PE=3 SV=1 173 500 6.0E-23
sp|B1KDF2|ASTD_SHEWM N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=astD PE=3 SV=1 170 490 6.0E-23
sp|Q3Z1H6|ABDH_SHISS Gamma-aminobutyraldehyde dehydrogenase OS=Shigella sonnei (strain Ss046) GN=prr PE=3 SV=1 113 500 7.0E-23
sp|A1RNU4|ASTD_SHESW N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=astD PE=3 SV=1 170 490 8.0E-23
sp|Q48CM6|BETB_PSE14 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betB PE=3 SV=1 173 500 8.0E-23
sp|A8FRE9|ASTD_SHESH N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=astD PE=3 SV=1 170 490 1.0E-22
sp|A0KN18|ASTD_AERHH N-succinylglutamate 5-semialdehyde dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=astD PE=3 SV=1 81 481 1.0E-22
sp|Q7KW39|MMSA_DROME Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Drosophila melanogaster GN=CG17896 PE=2 SV=1 71 503 1.0E-22
sp|B5Y007|BETB_KLEP3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=betB PE=3 SV=1 173 500 2.0E-22
sp|Q8ZPC9|ABDH_SALTY Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prr PE=3 SV=2 170 500 2.0E-22
sp|A0KST2|ASTD_SHESA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=astD PE=3 SV=1 170 490 2.0E-22
sp|Q83R90|ABDH_SHIFL Gamma-aminobutyraldehyde dehydrogenase OS=Shigella flexneri GN=prr PE=3 SV=1 113 500 2.0E-22
sp|Q4ZM62|BETB_PSEU2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betB PE=3 SV=1 173 500 2.0E-22
sp|B6IAI9|ABDH_ECOSE Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=prr PE=3 SV=1 113 500 2.0E-22
sp|B7LZ33|ABDH_ECO8A Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=prr PE=3 SV=1 113 500 2.0E-22
sp|A7ZLN7|ABDH_ECO24 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=prr PE=3 SV=1 113 500 2.0E-22
sp|Q0T431|ABDH_SHIF8 Gamma-aminobutyraldehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=prr PE=3 SV=1 113 500 2.0E-22
sp|B6EML5|ASTD_ALISL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=astD PE=3 SV=1 59 481 3.0E-22
sp|B7L6F9|ABDH_ECO55 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=prr PE=3 SV=1 113 500 3.0E-22
sp|P47771|ALDH2_YEAST Aldehyde dehydrogenase [NAD(P)+] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD2 PE=1 SV=2 59 487 3.0E-22
sp|Q8GAI8|SSDH_ARTNI Succinate-semialdehyde dehydrogenase OS=Arthrobacter nicotinovorans GN=sad PE=1 SV=1 170 500 3.0E-22
sp|P77674|ABDH_ECOLI Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=prr PE=1 SV=1 113 500 3.0E-22
sp|B1XDF5|ABDH_ECODH Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=prr PE=3 SV=1 113 500 3.0E-22
sp|C4ZVI3|ABDH_ECOBW Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=prr PE=3 SV=1 113 500 3.0E-22
sp|Q55585|GABD_SYNY3 Probable succinate-semialdehyde dehydrogenase [NADP(+)] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gabD PE=3 SV=1 61 500 3.0E-22
sp|A4JJG5|BETB_BURVG NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=betB PE=3 SV=1 95 500 3.0E-22
sp|O32507|GABD_DEIRA Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ssdA PE=3 SV=1 174 505 4.0E-22
sp|P38694|MSC7_YEAST Putative aldehyde dehydrogenase-like protein YHR039C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC7 PE=1 SV=1 65 501 4.0E-22
sp|Q29HB2|MMSA_DROPS Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA14712 PE=3 SV=1 72 503 4.0E-22
sp|A0PN13|GABD1_MYCUA Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium ulcerans (strain Agy99) GN=gabD1 PE=3 SV=1 171 500 4.0E-22
sp|B8CIT6|ASTD_SHEPW N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=astD PE=3 SV=1 170 490 4.0E-22
sp|B5FBM2|ASTD_VIBFM N-succinylglutamate 5-semialdehyde dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=astD PE=3 SV=1 58 481 5.0E-22
sp|Q4L919|ALDA_STAHJ Putative aldehyde dehydrogenase AldA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=aldA PE=3 SV=1 173 500 6.0E-22
sp|Q3BXK7|BETB_XANC5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betB PE=3 SV=1 171 500 6.0E-22
sp|B2K8U5|BETB_YERPB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betB PE=3 SV=1 173 500 7.0E-22
sp|A4TNP1|BETB_YERPP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=betB PE=3 SV=1 173 500 7.0E-22
sp|Q1CFR8|BETB_YERPN NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=betB PE=3 SV=1 173 500 7.0E-22
sp|Q8ZGV9|BETB_YERPE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis GN=betB PE=3 SV=1 173 500 7.0E-22
sp|Q1C931|BETB_YERPA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=betB PE=3 SV=1 173 500 7.0E-22
sp|Q8PPG7|BETB_XANAC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=betB PE=3 SV=1 171 500 9.0E-22
sp|B0RNV0|BETB_XANCB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betB PE=3 SV=1 171 500 9.0E-22
sp|Q4UYN4|BETB_XANC8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betB PE=3 SV=1 171 500 9.0E-22
sp|Q32FQ5|ABDH_SHIDS Gamma-aminobutyraldehyde dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=prr PE=3 SV=1 113 500 1.0E-21
sp|Q8P5D8|BETB_XANCP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=betB PE=3 SV=1 171 500 1.0E-21
sp|Q88AE9|BETB_PSESM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betB PE=3 SV=1 173 500 1.0E-21
sp|Q8UH56|BETB_AGRFC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=betB PE=1 SV=1 174 500 1.0E-21
sp|Q4V1F6|IOLA3_BACCZ Methylmalonate semialdehyde dehydrogenase [acylating] 3 OS=Bacillus cereus (strain ZK / E33L) GN=iolA3 PE=3 SV=1 174 486 1.0E-21
sp|B3PTE1|BETB_RHIE6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=betB PE=3 SV=1 174 500 1.0E-21
sp|Q488Y0|ASTD_COLP3 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=astD PE=3 SV=1 81 490 2.0E-21
sp|Q9P7K9|YOSF_SCHPO Putative aldehyde dehydrogenase-like protein C21C3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.15c PE=3 SV=1 115 500 2.0E-21
sp|A9L3U4|ASTD_SHEB9 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella baltica (strain OS195) GN=astD PE=3 SV=1 83 490 2.0E-21
sp|A3D039|ASTD_SHEB5 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=astD PE=3 SV=1 83 490 2.0E-21
sp|A6WST7|ASTD_SHEB8 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella baltica (strain OS185) GN=astD PE=3 SV=1 108 490 2.0E-21
sp|B8EBC2|ASTD_SHEB2 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella baltica (strain OS223) GN=astD PE=3 SV=1 170 490 2.0E-21
sp|A7MX96|ASTD_VIBCB N-succinylglutamate 5-semialdehyde dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=astD PE=3 SV=1 170 481 2.0E-21
sp|Q66D53|BETB_YERPS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betB PE=3 SV=1 173 500 2.0E-21
sp|Q87L22|ASTD_VIBPA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=astD PE=3 SV=1 170 481 2.0E-21
sp|Q7QC84|MMSA_ANOGA Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Anopheles gambiae GN=AGAP002499 PE=3 SV=2 72 503 3.0E-21
sp|Q6D6Y7|ABDH_PECAS Gamma-aminobutyraldehyde dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=prr PE=3 SV=1 170 500 3.0E-21
sp|Q8EJ54|ASTD_SHEON N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=astD PE=3 SV=1 170 490 3.0E-21
sp|B7LR95|ABDH_ESCF3 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=prr PE=3 SV=1 113 500 4.0E-21
sp|A6U6Y9|BETB_SINMW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betB PE=3 SV=1 174 500 4.0E-21
sp|Q8K009|AL1L2_MOUSE Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus GN=Aldh1l2 PE=1 SV=2 173 500 5.0E-21
sp|Q59931|GAPN_STRMU NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gapN PE=1 SV=2 170 501 5.0E-21
sp|Q6D6E0|BETB_PECAS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=betB PE=3 SV=1 173 500 5.0E-21
sp|B1IS15|ABDH_ECOLC Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=prr PE=3 SV=1 113 500 6.0E-21
sp|A8A002|ABDH_ECOHS Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=prr PE=3 SV=1 113 500 6.0E-21
sp|H2IFE7|AHGD_VIBSJ 3,6-anhydro-alpha-L-galactose dehydrogenase OS=Vibrio sp. (strain EJY3) GN=Vejahgd PE=1 SV=1 62 500 6.0E-21
sp|C3MIE5|BETB_RHISN NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betB PE=3 SV=1 174 500 6.0E-21
sp|Q3SY69|AL1L2_HUMAN Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens GN=ALDH1L2 PE=1 SV=2 173 500 6.0E-21
sp|B5ZUG3|BETB_RHILW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betB PE=3 SV=1 174 500 6.0E-21
sp|Q2KB42|BETB_RHIEC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betB PE=3 SV=1 174 500 6.0E-21
sp|Q3IC91|ASTD2_PSEHT N-succinylglutamate 5-semialdehyde dehydrogenase 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=astD2 PE=3 SV=1 170 481 7.0E-21
sp|Q5E2G9|ASTD_VIBF1 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=astD PE=3 SV=1 59 481 7.0E-21
sp|A4WAR9|ABDH_ENT38 Gamma-aminobutyraldehyde dehydrogenase OS=Enterobacter sp. (strain 638) GN=prr PE=3 SV=1 170 500 8.0E-21
sp|Q1MJU3|BETB_RHIL3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betB PE=3 SV=1 174 500 8.0E-21
sp|B5Z0W0|ABDH_ECO5E Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=prr PE=3 SV=1 113 500 9.0E-21
sp|Q8X9W5|ABDH_ECO57 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O157:H7 GN=prr PE=3 SV=1 113 500 9.0E-21
sp|A8AGJ9|ABDH_CITK8 Gamma-aminobutyraldehyde dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=prr PE=3 SV=1 170 500 9.0E-21
sp|Q17M80|MMSA_AEDAE Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Aedes aegypti GN=AAEL001134 PE=3 SV=1 72 503 1.0E-20
sp|B1LFH3|ABDH_ECOSM Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=prr PE=3 SV=1 113 500 1.0E-20
sp|A4SK35|ASTD_AERS4 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=astD PE=3 SV=1 92 481 1.0E-20
sp|O52485|PUTA_ENTAE Bifunctional protein PutA OS=Enterobacter aerogenes GN=putA PE=3 SV=1 106 495 1.0E-20
sp|B7N4K1|ABDH_ECOLU Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|P83401|AL7A1_DICDI Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Dictyostelium discoideum GN=DDB_G0276821 PE=3 SV=2 95 499 2.0E-20
sp|B7URJ0|ABDH_ECO27 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|Q1RBX3|ABDH_ECOUT Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|Q8FHK7|ABDH_ECOL6 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|Q0THX6|ABDH_ECOL5 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|A1AB46|ABDH_ECOK1 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=prr PE=3 SV=1 113 500 2.0E-20
sp|B7MUN0|ABDH_ECO81 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|B7MMS8|ABDH_ECO45 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=prr PE=3 SV=1 113 500 2.0E-20
sp|Q8Z747|ABDH_SALTI Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella typhi GN=prr PE=3 SV=2 170 500 2.0E-20
sp|A9MQY3|ABDH_SALAR Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=prr PE=3 SV=1 170 500 2.0E-20
sp|A9MYQ4|ABDH_SALPB Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=prr PE=3 SV=1 170 500 2.0E-20
sp|A5YBJ3|IOLA_LACCA Methylmalonate semialdehyde dehydrogenase [acylating] OS=Lactobacillus casei GN=iolA PE=3 SV=1 174 501 3.0E-20
sp|Q5RFM9|AL1L1_PONAB Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Pongo abelii GN=ALDH1L1 PE=2 SV=1 173 500 3.0E-20
sp|Q2G9T9|ASTD_NOVAD N-succinylglutamate 5-semialdehyde dehydrogenase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=astD PE=3 SV=1 170 481 3.0E-20
sp|O75891|AL1L1_HUMAN Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens GN=ALDH1L1 PE=1 SV=2 173 500 3.0E-20
sp|O74766|PUT2_SCHPO Probable delta-1-pyrroline-5-carboxylate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC24C6.04 PE=1 SV=1 169 511 4.0E-20
sp|A8GHZ8|ABDH_SERP5 Gamma-aminobutyraldehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=prr PE=3 SV=1 170 500 4.0E-20
sp|Q79EM7|PHDK_NOCSK 2-formylbenzoate dehydrogenase OS=Nocardioides sp. (strain KP7) GN=phdK PE=1 SV=1 165 503 4.0E-20
sp|B5YQ33|ASTD_ECO5E N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=astD PE=3 SV=1 170 490 5.0E-20
sp|Q7ADE6|ASTD_ECO57 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli O157:H7 GN=astD PE=3 SV=1 170 490 5.0E-20
sp|Q8EMV4|IOLA2_OCEIH Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=iolA2 PE=3 SV=1 174 429 5.0E-20
sp|Q12QD2|ASTD1_SHEDO N-succinylglutamate 5-semialdehyde dehydrogenase 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=astD1 PE=3 SV=1 170 481 5.0E-20
sp|Q5KYR4|IOLA2_GEOKA Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Geobacillus kaustophilus (strain HTA426) GN=iolA2 PE=3 SV=2 174 486 5.0E-20
sp|A6T7T5|ASTD_KLEP7 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=astD PE=3 SV=1 170 490 6.0E-20
sp|Q63ZT8|AL1L1_XENTR Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Xenopus tropicalis GN=aldh1l1 PE=2 SV=1 173 500 6.0E-20
sp|Q07XY1|ASTD_SHEFN N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=astD PE=3 SV=1 108 490 6.0E-20
sp|B7VLI4|ASTD_VIBTL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=astD PE=3 SV=1 170 481 6.0E-20
sp|P52713|MMSA_CAEEL Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Caenorhabditis elegans GN=alh-8 PE=3 SV=1 59 514 7.0E-20
sp|Q5PHV8|ABDH_SALPA Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=prr PE=3 SV=2 170 500 8.0E-20
sp|Q9A7W2|ASTD2_CAUCR N-succinylglutamate 5-semialdehyde dehydrogenase 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=astD2 PE=3 SV=1 81 481 8.0E-20
sp|P28037|AL1L1_RAT Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Rattus norvegicus GN=Aldh1l1 PE=1 SV=3 173 500 9.0E-20
sp|Q6GNL7|AL1L1_XENLA Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Xenopus laevis GN=aldh1l1 PE=2 SV=1 173 500 1.0E-19
sp|B7NT31|ASTD_ECO7I N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=astD PE=3 SV=1 170 490 1.0E-19
sp|A5ICK3|ASTD_LEGPC N-succinylglutamate 5-semialdehyde dehydrogenase OS=Legionella pneumophila (strain Corby) GN=astD PE=3 SV=1 170 490 1.0E-19
sp|Q5ZUT5|ASTD_LEGPH N-succinylglutamate 5-semialdehyde dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=astD PE=3 SV=1 170 490 1.0E-19
sp|Q12JA9|ASTD2_SHEDO N-succinylglutamate 5-semialdehyde dehydrogenase 2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=astD2 PE=3 SV=1 170 490 2.0E-19
sp|A4IPB2|IOLA1_GEOTN Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolA1 PE=3 SV=2 174 486 2.0E-19
sp|B7M1F8|ASTD_ECO8A N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=astD PE=3 SV=1 170 490 2.0E-19
sp|A7ZML4|ASTD_ECO24 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=astD PE=3 SV=1 170 490 2.0E-19
sp|Q81QB6|IOLA2_BACAN Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus anthracis GN=iolA2 PE=3 SV=1 174 486 2.0E-19
sp|Q1WIQ6|GAPN_ARATH NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana GN=ALDH11A3 PE=1 SV=2 174 484 2.0E-19
sp|B1IPI4|ASTD_ECOLC N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=astD PE=3 SV=1 170 490 2.0E-19
sp|Q6HIK3|IOLA2_BACHK Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=iolA2 PE=3 SV=1 174 486 3.0E-19
sp|B7L6M0|ASTD_ECO55 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=astD PE=3 SV=1 170 490 3.0E-19
sp|P54222|BETB1_RHIME NAD/NADP-dependent betaine aldehyde dehydrogenase 1 OS=Rhizobium meliloti (strain 1021) GN=betB1 PE=3 SV=2 174 500 3.0E-19
sp|A8A0T8|ASTD_ECOHS N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=astD PE=3 SV=1 170 490 3.0E-19
sp|B2VJX8|ASTD_ERWT9 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=astD PE=3 SV=1 106 490 3.0E-19
sp|A7MNV8|ASTD_CROS8 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=astD PE=3 SV=1 170 490 3.0E-19
sp|A0REB5|IOLA2_BACAH Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=iolA2 PE=3 SV=2 174 486 3.0E-19
sp|Q0T4V3|ASTD_SHIF8 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=astD PE=3 SV=1 170 490 4.0E-19
sp|B6IBG6|ASTD_ECOSE N-succinylglutamate 5-semialdehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=astD PE=3 SV=1 174 490 4.0E-19
sp|B2U3C8|ASTD_SHIB3 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=astD PE=3 SV=1 170 490 5.0E-19
sp|Q6LVE5|ASTD_PHOPR N-succinylglutamate 5-semialdehyde dehydrogenase OS=Photobacterium profundum GN=astD PE=3 SV=1 170 481 5.0E-19
sp|A4JCW0|ASTD_BURVG N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=astD PE=3 SV=1 66 481 5.0E-19
sp|Q9L4K1|BETB_CHRSD NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betB PE=3 SV=1 173 500 6.0E-19
sp|Q7UCI7|ASTD_SHIFL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Shigella flexneri GN=astD PE=3 SV=1 170 490 6.0E-19
sp|A8GFQ3|ASTD_SERP5 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=astD PE=3 SV=1 92 490 6.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 564 582 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 63.52 34.42 92.62
CcL In ants, during behavior modification 24.02 11.82 36.22
CcD In ants, recently dead 36.66 19.55 53.77

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.010603 yes
CcL CcD 0.070148 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3917
MRFADLGAVAKAPPPLPRQSASSSSSSVSLLLFLVIPLLILVAVDIIATSSSHAFVAMIVSIPPFASTPVADIQA
GYDRLRSTFRSGRTRNLEYRKRQIRRLYWGLDDLRPALVEALRRDMGKSAHEANLSEIDWVQAEAIDMCNNLDDW
ARDESVVGLPLVYRPMSPRIQFEPLGSVLVIGPFNFPVMLNVSAVMGAIAAGNTVVLKPSEQSPHSAMVLKQLFE
EYVDPDVVFCVNGAIPETQALLDLKFDKVAFTGGRKAGTIIATKAAQSLTPVLLELGGRNPAFINKDANVALAAR
RLLWQKCLNAGQICLTHNYALVHRPLVSGFVDELKLQYRTFMPQGAKVSPDYSRIVNQNHFRRIKAMLDNTNGKV
VLGGSSDEADLFIEPTVVVVNDVDDSMMTEESFGPVWSIVPYDSVEEAIDMANSIDPTPLALYTFGSDEDNNKVL
SNVTSGGASINDGMFHAILQATPFGGIGGSGMGNYHGYYSFRAFSHLRTICKVPSWADRILRVRYMPYSSGELQR
YRRVLLPKPNFDRDGNVVRGLSYWLGLVLALGGRSKRSIALRWGLLAIVALGLGLGADWTR
Coding >Ophio5|3917
ATGCGCTTTGCCGATTTGGGTGCTGTCGCGAAAGCTCCTCCTCCTCTTCCTCGTCAGTCAGCCTCCTCCTCTTCC
TCGTCAGTCAGCCTCCTCCTCTTCCTCGTCATCCCCCTCTTGATCCTCGTCGCCGTCGACATCATCGCCACATCG
TCGTCTCACGCTTTCGTCGCCATGATCGTCTCCATCCCGCCCTTCGCGTCGACGCCCGTGGCCGACATCCAGGCC
GGCTACGACCGTCTGCGTTCGACTTTTCGCTCCGGCCGCACCAGGAACCTCGAGTACCGCAAGAGGCAGATTCGC
CGCCTCTACTGGGGCCTCGACGACCTTCGTCCCGCCCTGGTCGAGGCACTGCGGCGCGACATGGGCAAGTCCGCC
CACGAGGCCAACTTGTCCGAGATCGACTGGGTCCAGGCAGAGGCTATCGACATGTGCAACAATCTCGACGACTGG
GCGCGCGACGAGTCGGTTGTCGGCCTGCCCCTTGTCTATCGTCCCATGAGCCCGCGTATTCAGTTTGAGCCTCTG
GGCTCCGTTCTCGTCATCGGCCCCTTCAACTTCCCTGTCATGCTCAACGTCTCGGCCGTCATGGGCGCCATCGCC
GCTGGCAACACCGTCGTCCTCAAGCCCTCGGAGCAATCACCCCACAGCGCCATGGTCCTCAAGCAGTTGTTCGAA
GAGTACGTCGACCCGGACGTCGTCTTCTGCGTCAACGGCGCCATTCCCGAGACCCAGGCCCTACTCGACCTCAAG
TTCGACAAGGTGGCCTTTACCGGCGGCCGCAAAGCCGGCACAATCATCGCCACCAAGGCCGCTCAGTCCCTGACG
CCCGTCCTCCTCGAGCTCGGTGGCCGCAACCCGGCCTTTATCAACAAGGACGCCAACGTCGCCCTTGCCGCCCGC
CGCCTGCTCTGGCAAAAGTGCCTCAACGCCGGTCAGATTTGTCTCACTCACAACTATGCCCTCGTTCACCGCCCG
CTCGTCTCGGGCTTCGTCGACGAGCTCAAGCTTCAGTACCGCACCTTTATGCCCCAAGGCGCCAAGGTCAGCCCC
GACTATTCTCGCATCGTCAACCAGAACCACTTCCGTCGCATCAAGGCCATGCTCGACAACACCAACGGCAAGGTC
GTCTTGGGCGGCTCTTCGGACGAGGCTGATCTCTTCATCGAGCCCACCGTCGTCGTCGTCAACGACGTGGACGAC
TCCATGATGACCGAGGAGAGCTTCGGCCCCGTCTGGTCCATCGTGCCCTACGACTCCGTCGAAGAGGCCATCGAC
ATGGCCAATAGTATAGACCCCACCCCGTTGGCCCTCTACACCTTTGGCTCCGACGAGGACAACAACAAAGTACTC
TCCAACGTCACATCGGGTGGCGCCTCTATCAACGACGGCATGTTCCACGCCATTCTACAGGCCACTCCCTTTGGC
GGCATTGGTGGATCCGGCATGGGCAATTACCACGGCTACTACTCGTTCCGCGCCTTTAGCCACCTGCGCACCATC
TGCAAGGTACCCAGCTGGGCCGACAGAATTCTTCGCGTGCGGTACATGCCCTACTCGAGCGGGGAGCTTCAGCGG
TACAGAAGAGTCTTGTTGCCCAAGCCCAACTTTGACCGCGACGGAAACGTCGTCAGGGGCCTCTCCTACTGGCTC
GGTCTGGTCCTGGCCCTGGGCGGTAGGAGCAAGAGGTCGATTGCGCTGCGGTGGGGGCTCCTGGCCATTGTTGCT
CTGGGGCTGGGCCTGGGTGCTGACTGGACGCGA
Transcript >Ophio5|3917
ATGCGCTTTGCCGATTTGGGTGCTGTCGCGAAAGCTCCTCCTCCTCTTCCTCGTCAGTCAGCCTCCTCCTCTTCC
TCGTCAGTCAGCCTCCTCCTCTTCCTCGTCATCCCCCTCTTGATCCTCGTCGCCGTCGACATCATCGCCACATCG
TCGTCTCACGCTTTCGTCGCCATGATCGTCTCCATCCCGCCCTTCGCGTCGACGCCCGTGGCCGACATCCAGGCC
GGCTACGACCGTCTGCGTTCGACTTTTCGCTCCGGCCGCACCAGGAACCTCGAGTACCGCAAGAGGCAGATTCGC
CGCCTCTACTGGGGCCTCGACGACCTTCGTCCCGCCCTGGTCGAGGCACTGCGGCGCGACATGGGCAAGTCCGCC
CACGAGGCCAACTTGTCCGAGATCGACTGGGTCCAGGCAGAGGCTATCGACATGTGCAACAATCTCGACGACTGG
GCGCGCGACGAGTCGGTTGTCGGCCTGCCCCTTGTCTATCGTCCCATGAGCCCGCGTATTCAGTTTGAGCCTCTG
GGCTCCGTTCTCGTCATCGGCCCCTTCAACTTCCCTGTCATGCTCAACGTCTCGGCCGTCATGGGCGCCATCGCC
GCTGGCAACACCGTCGTCCTCAAGCCCTCGGAGCAATCACCCCACAGCGCCATGGTCCTCAAGCAGTTGTTCGAA
GAGTACGTCGACCCGGACGTCGTCTTCTGCGTCAACGGCGCCATTCCCGAGACCCAGGCCCTACTCGACCTCAAG
TTCGACAAGGTGGCCTTTACCGGCGGCCGCAAAGCCGGCACAATCATCGCCACCAAGGCCGCTCAGTCCCTGACG
CCCGTCCTCCTCGAGCTCGGTGGCCGCAACCCGGCCTTTATCAACAAGGACGCCAACGTCGCCCTTGCCGCCCGC
CGCCTGCTCTGGCAAAAGTGCCTCAACGCCGGTCAGATTTGTCTCACTCACAACTATGCCCTCGTTCACCGCCCG
CTCGTCTCGGGCTTCGTCGACGAGCTCAAGCTTCAGTACCGCACCTTTATGCCCCAAGGCGCCAAGGTCAGCCCC
GACTATTCTCGCATCGTCAACCAGAACCACTTCCGTCGCATCAAGGCCATGCTCGACAACACCAACGGCAAGGTC
GTCTTGGGCGGCTCTTCGGACGAGGCTGATCTCTTCATCGAGCCCACCGTCGTCGTCGTCAACGACGTGGACGAC
TCCATGATGACCGAGGAGAGCTTCGGCCCCGTCTGGTCCATCGTGCCCTACGACTCCGTCGAAGAGGCCATCGAC
ATGGCCAATAGTATAGACCCCACCCCGTTGGCCCTCTACACCTTTGGCTCCGACGAGGACAACAACAAAGTACTC
TCCAACGTCACATCGGGTGGCGCCTCTATCAACGACGGCATGTTCCACGCCATTCTACAGGCCACTCCCTTTGGC
GGCATTGGTGGATCCGGCATGGGCAATTACCACGGCTACTACTCGTTCCGCGCCTTTAGCCACCTGCGCACCATC
TGCAAGGTACCCAGCTGGGCCGACAGAATTCTTCGCGTGCGGTACATGCCCTACTCGAGCGGGGAGCTTCAGCGG
TACAGAAGAGTCTTGTTGCCCAAGCCCAACTTTGACCGCGACGGAAACGTCGTCAGGGGCCTCTCCTACTGGCTC
GGTCTGGTCCTGGCCCTGGGCGGTAGGAGCAAGAGGTCGATTGCGCTGCGGTGGGGGCTCCTGGCCATTGTTGCT
CTGGGGCTGGGCCTGGGTGCTGACTGGACGCGATGA
Gene >Ophio5|3917
ATGCGCTTTGCCGATTTGGGTGCTGTCGCGAAAGCTCCTCCTCCTCTTCCTCGTCAGTCAGCCTCCTCCTCTTCC
TCGTCAGTCAGCCTCCTCCTCTTCCTCGTCATCCCCCTCTTGATCCTCGTCGCCGTCGACATCATCGCCACATCG
TCGTCTCACGCTTTCGTCGCCATGATCGTCTCCATCCCGCCCTTCGCGTCGACGCCCGTGGCCGACATCCAGGCC
GGCTACGACCGTCTGCGTTCGACTTTTCGCTCCGGCCGCACCAGGAACCTCGAGTACCGCAAGAGGCAGATTCGC
CGCCTCTACTGGGGCCTCGACGACCTTCGTCCCGCCCTGGTCGAGGCACTGCGGCGCGACATGGGCAAGTCCGCC
CACGAGGCCAACTTGTCCGAGATCGACTGGGTCCAGGCAGAGGCTATCGACATGTGCAACAATCTCGACGACTGG
GCGCGCGACGAGTCGGTTGTCGGCCTGCCCCTTGTCTATCGTCCCATGAGCCCGCGTATTCAGTTTGAGCCTCTG
GGCTCCGTTCTCGTCATCGGCCCCTTCAACTTCCCTGTCATGCTCAACGTCTCGGCCGTCATGGGCGCCATCGCC
GCTGGCAACACCGTCGTCCTCAAGCCCTCGGAGCAATCACCCCACAGCGCCATGGTCCTCAAGCAGTTGTTCGAA
GAGTACGTCGACCCGGACGTCGTCTTCTGCGTCAACGGCGCCATTCCCGAGACCCAGGCCCTACTCGACCTCAAG
TTCGACAAGGTGGCCTTTACCGGCGGCCGCAAAGCCGGCACAATCATCGCCACCAAGGCCGCTCAGTCCCTGACG
CCCGTCCTCCTCGAGCTCGGTGGCCGCAACCCGGCCTTTATCAACAAGGACGCCAACGTCGCCCTTGCCGCCCGC
CGCCTGCTCTGGCAAAAGTGCCTCAACGCCGGTCAGATTTGTCTCACTCACAACTATGCCCTCGTTCACCGCCCG
CTCGTCTCGGGCTTCGTCGACGAGCTCAAGCTTCAGTACCGCACCTTTATGCCCCAAGGCGCCAAGGTCAGCCCC
GACTATTCTCGCATCGTCAACCAGAACCACTTCCGTCGCATCAAGGCCATGCTCGACAACACCAACGGCAAGGTC
GTCTTGGGCGGCTCTTCGGACGAGGCTGATCTCTTCATCGAGCCCACCGTCGTCGTCGTCAACGACGTGGACGAC
TCCATGATGACCGAGGAGAGCTTCGGCCCCGTCTGGTCCATCGTGCCCTACGACTCCGTCGAAGAGGCCATCGAC
ATGGCCAATAGTATAGACCCCACCCCGTTGGCCCTCTACACCTTTGGCTCCGACGAGGACAACAACAAAGGTGGG
TTTTCTCGCCTCCGCACCACAGCTCGTTACTGACGGCACAACAAGTACTCTCCAACGTCACATCGGGTGGCGCCT
CTATCAACGACGGCATGTTCCACGCCATTCTACAGGCCACTCCCTTTGGCGGCATTGGTGGATCCGGCATGGGCA
ATTACCACGGCTACTACTCGTTCCGCGCCTTTAGCCACCTGCGCACCATCTGCAAGGTACCCAGCTGGGCCGACA
GAATTCTTCGCGTGCGGTACATGCCCTACTCGAGCGGGGAGCTTCAGCGGTACAGAAGAGTCTTGTTGCCCAAGC
CCAACTTTGACCGCGACGGAAACGTCGTCAGGGGCCTCTCCTACTGGCTCGGTCTGGTCCTGGCCCTGGGCGGTA
GGAGCAAGAGGTCGATTGCGCTGCGGTGGGGGCTCCTGGCCATTGTTGCTCTGGGGCTGGGCCTGGGTGCTGACT
GGACGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail