Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3916
Gene name
Locationscaffold_306:231..1408
Strand+
Gene length (bp)1177
Transcript length (bp)1017
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region 4.1E-13 49 86

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09704|RRP4_SCHPO Exosome complex component rrp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp4 PE=3 SV=1 37 310 3.0E-78
sp|P38792|RRP4_YEAST Exosome complex component RRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP4 PE=1 SV=1 40 310 1.0E-65
sp|Q13868|EXOS2_HUMAN Exosome complex component RRP4 OS=Homo sapiens GN=EXOSC2 PE=1 SV=2 34 306 2.0E-54
sp|Q8VBV3|EXOS2_MOUSE Exosome complex component RRP4 OS=Mus musculus GN=Exosc2 PE=1 SV=1 34 306 1.0E-53
sp|Q2KID0|EXOS2_BOVIN Exosome complex component RRP4 OS=Bos taurus GN=EXOSC2 PE=2 SV=1 34 306 3.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09704|RRP4_SCHPO Exosome complex component rrp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp4 PE=3 SV=1 37 310 3.0E-78
sp|P38792|RRP4_YEAST Exosome complex component RRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP4 PE=1 SV=1 40 310 1.0E-65
sp|Q13868|EXOS2_HUMAN Exosome complex component RRP4 OS=Homo sapiens GN=EXOSC2 PE=1 SV=2 34 306 2.0E-54
sp|Q8VBV3|EXOS2_MOUSE Exosome complex component RRP4 OS=Mus musculus GN=Exosc2 PE=1 SV=1 34 306 1.0E-53
sp|Q2KID0|EXOS2_BOVIN Exosome complex component RRP4 OS=Bos taurus GN=EXOSC2 PE=2 SV=1 34 306 3.0E-53
sp|Q9ZVT7|RRP4_ARATH Exosome complex component RRP4 homolog OS=Arabidopsis thaliana GN=RRP4 PE=1 SV=1 42 312 1.0E-43
sp|O26780|RRP4_METTH Exosome complex component Rrp4 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rrp4 PE=3 SV=1 47 246 2.0E-11
sp|A5UJS0|RRP4_METS3 Exosome complex component Rrp4 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rrp4 PE=3 SV=1 47 239 2.0E-11
sp|Q8U0L8|RRP4_PYRFU Exosome complex component Rrp4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rrp4 PE=3 SV=1 47 242 3.0E-11
sp|O59221|RRP4_PYRHO Exosome complex component Rrp4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rrp4 PE=3 SV=1 47 250 1.0E-10
sp|Q97BZ6|RRP4_THEVO Exosome complex component Rrp4 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rrp4 PE=3 SV=1 64 244 2.0E-10
sp|Q5JIR5|RRP4_THEKO Exosome complex component Rrp4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rrp4 PE=3 SV=1 47 242 2.0E-10
sp|Q9V120|RRP4_PYRAB Exosome complex component Rrp4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rrp4 PE=3 SV=1 47 242 2.0E-10
sp|Q9HIP3|RRP4_THEAC Exosome complex component Rrp4 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rrp4 PE=3 SV=1 77 244 3.0E-10
sp|Q6L222|RRP4_PICTO Exosome complex component Rrp4 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rrp4 PE=3 SV=1 77 253 8.0E-10
sp|O29758|RRP4_ARCFU Exosome complex component Rrp4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rrp4 PE=1 SV=1 47 239 7.0E-09
sp|E3GZ90|RRP4_METFV Exosome complex component Rrp4 OS=Methanothermus fervidus (strain ATCC 43054 / DSM 2088 / JCM 10308 / V24 S) GN=rrp4 PE=3 SV=1 47 239 2.0E-08
sp|Q12ZB8|RRP4_METBU Exosome complex component Rrp4 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rrp4 PE=3 SV=1 47 239 3.0E-07
sp|Q8TYC0|RRP4_METKA Exosome complex component Rrp4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rrp4 PE=3 SV=1 47 245 4.0E-07
sp|Q2NEX6|RRP4_METST Exosome complex component Rrp4 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rrp4 PE=3 SV=1 47 239 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3916
MPITILQPKPVPEHPPPYSDSDSDGGVDIQDEGPSRKRLRRSSSSGLLTPGTVITSNSQWMRGHGTYVPPGTTSI
TSSLAGTLARTNKLLSVRPLRARYRPEIGDLVVGRIVEVQPRRWRVDVAASQLALLHMSAINLPGGILRKRTETD
MLQIRSFFAEGDLLVAEVQQLHADGVAALHTRSLRYGKLRNGVFVAVSGSLGNAAGVVRAKRQLWTVDNPAHGAA
PIEITLGVNGYIWICKRVEPDDAAADGFNRPDDAVSGGLYSSQNDAIDVPTMREIARFRSVILALVQHGLRVDED
TVTRAYAEAVDLGAESPDDDLYLGGDRGRRLAASLSMS
Coding >Ophio5|3916
ATGCCCATCACCATCCTCCAGCCCAAGCCCGTCCCCGAACACCCTCCCCCATATTCCGACTCCGACTCCGACGGC
GGCGTCGACATCCAAGACGAGGGCCCTAGCCGGAAGCGTCTCCGCCGAAGCTCTTCTTCTGGACTCCTGACTCCC
GGCACCGTCATCACCTCCAACTCACAATGGATGCGCGGCCACGGAACCTACGTCCCCCCGGGCACAACATCCATC
ACCTCCTCCCTGGCCGGAACCCTCGCCCGGACAAACAAGCTGCTCTCCGTGCGTCCGCTGCGGGCCCGCTACCGT
CCCGAGATTGGCGATCTGGTGGTAGGCCGCATCGTCGAAGTTCAGCCTCGGAGATGGCGCGTCGACGTGGCCGCC
TCCCAGCTCGCGCTGCTGCACATGTCGGCCATCAATCTTCCCGGTGGCATCTTGCGCAAGCGTACCGAGACGGAT
ATGCTACAGATTCGCTCCTTTTTCGCTGAGGGCGACCTGCTCGTCGCAGAGGTTCAGCAGTTGCATGCTGATGGC
GTCGCCGCTTTGCATACTCGTAGCTTGCGCTATGGCAAGTTACGCAATGGCGTCTTCGTCGCCGTTTCTGGTTCC
CTCGGTAATGCTGCCGGCGTCGTTCGCGCAAAGAGGCAGCTCTGGACCGTCGACAATCCTGCTCATGGCGCCGCG
CCCATCGAAATCACCCTCGGCGTAAACGGCTACATCTGGATCTGCAAGCGAGTCGAGCCCGACGACGCTGCCGCC
GATGGCTTCAACCGCCCCGACGACGCCGTATCGGGCGGCCTCTACTCCAGCCAGAACGACGCCATCGACGTTCCC
ACCATGAGAGAGATTGCCCGCTTCCGTAGCGTCATCCTCGCCCTCGTCCAGCACGGCCTGCGCGTCGACGAGGAT
ACCGTCACCAGGGCCTACGCCGAGGCCGTCGACTTGGGCGCCGAGTCGCCCGACGATGACTTGTATCTCGGCGGC
GACAGGGGGCGCAGGCTGGCCGCATCCCTGTCCATGTCC
Transcript >Ophio5|3916
ATGCCCATCACCATCCTCCAGCCCAAGCCCGTCCCCGAACACCCTCCCCCATATTCCGACTCCGACTCCGACGGC
GGCGTCGACATCCAAGACGAGGGCCCTAGCCGGAAGCGTCTCCGCCGAAGCTCTTCTTCTGGACTCCTGACTCCC
GGCACCGTCATCACCTCCAACTCACAATGGATGCGCGGCCACGGAACCTACGTCCCCCCGGGCACAACATCCATC
ACCTCCTCCCTGGCCGGAACCCTCGCCCGGACAAACAAGCTGCTCTCCGTGCGTCCGCTGCGGGCCCGCTACCGT
CCCGAGATTGGCGATCTGGTGGTAGGCCGCATCGTCGAAGTTCAGCCTCGGAGATGGCGCGTCGACGTGGCCGCC
TCCCAGCTCGCGCTGCTGCACATGTCGGCCATCAATCTTCCCGGTGGCATCTTGCGCAAGCGTACCGAGACGGAT
ATGCTACAGATTCGCTCCTTTTTCGCTGAGGGCGACCTGCTCGTCGCAGAGGTTCAGCAGTTGCATGCTGATGGC
GTCGCCGCTTTGCATACTCGTAGCTTGCGCTATGGCAAGTTACGCAATGGCGTCTTCGTCGCCGTTTCTGGTTCC
CTCGGTAATGCTGCCGGCGTCGTTCGCGCAAAGAGGCAGCTCTGGACCGTCGACAATCCTGCTCATGGCGCCGCG
CCCATCGAAATCACCCTCGGCGTAAACGGCTACATCTGGATCTGCAAGCGAGTCGAGCCCGACGACGCTGCCGCC
GATGGCTTCAACCGCCCCGACGACGCCGTATCGGGCGGCCTCTACTCCAGCCAGAACGACGCCATCGACGTTCCC
ACCATGAGAGAGATTGCCCGCTTCCGTAGCGTCATCCTCGCCCTCGTCCAGCACGGCCTGCGCGTCGACGAGGAT
ACCGTCACCAGGGCCTACGCCGAGGCCGTCGACTTGGGCGCCGAGTCGCCCGACGATGACTTGTATCTCGGCGGC
GACAGGGGGCGCAGGCTGGCCGCATCCCTGTCCATGTCCTGA
Gene >Ophio5|3916
ATGCCCATCACCATCCTCCAGCCCAAGCCCGTCCCCGAACACCCTCCCCCATATTCCGACTCCGACTCCGACGGC
GGCGTCGACATCCAAGACGAGGGCCCTAGCCGGAAGCGTCTCCGCCGAAGCTCTTCTTCTGGACTCCTGACTCCC
GGCACCGTCATCACCTCCAACTCACAATGGATGCGGTGCGCGCTCTCCCTCTCTGTCTCCCTCCCTCCCTCCCTC
TCTTTCTCTCTCCCCTATCCCCCTATCCCCACCACTCTTTCACTCTTTTTTTTTTTTCTTTGGCTTTCTTCTAAC
ATCTTTTTTCTTTTTGTCTTTGCCCCCCCCCCCTCCCCCCCTCAGCGGCCACGGAACCTACGTCCCCCCGGGCAC
AACATCCATCACCTCCTCCCTGGCCGGAACCCTCGCCCGGACAAACAAGCTGCTCTCCGTGCGTCCGCTGCGGGC
CCGCTACCGTCCCGAGATTGGCGATCTGGTGGTAGGCCGCATCGTCGAAGTTCAGCCTCGGAGATGGCGCGTCGA
CGTGGCCGCCTCCCAGCTCGCGCTGCTGCACATGTCGGCCATCAATCTTCCCGGTGGCATCTTGCGCAAGCGTAC
CGAGACGGATATGCTACAGATTCGCTCCTTTTTCGCTGAGGGCGACCTGCTCGTCGCAGAGGTTCAGCAGTTGCA
TGCTGATGGCGTCGCCGCTTTGCATACTCGTAGCTTGCGCTATGGCAAGTTACGCAATGGCGTCTTCGTCGCCGT
TTCTGGTTCCCTCGGTAATGCTGCCGGCGTCGTTCGCGCAAAGAGGCAGCTCTGGACCGTCGACAATCCTGCTCA
TGGCGCCGCGCCCATCGAAATCACCCTCGGCGTAAACGGCTACATCTGGATCTGCAAGCGAGTCGAGCCCGACGA
CGCTGCCGCCGATGGCTTCAACCGCCCCGACGACGCCGTATCGGGCGGCCTCTACTCCAGCCAGAACGACGCCAT
CGACGTTCCCACCATGAGAGAGATTGCCCGCTTCCGTAGCGTCATCCTCGCCCTCGTCCAGCACGGCCTGCGCGT
CGACGAGGATACCGTCACCAGGGCCTACGCCGAGGCCGTCGACTTGGGCGCCGAGTCGCCCGACGATGACTTGTA
TCTCGGCGGCGACAGGGGGCGCAGGCTGGCCGCATCCCTGTCCATGTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail