Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3915
Gene name
Locationscaffold_305:21667..23540
Strand-
Gene length (bp)1873
Transcript length (bp)1704
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00962 A_deaminase Adenosine deaminase 1.9E-22 227 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2VQV9|CECR1_XENLA Adenosine deaminase CECR1 OS=Xenopus laevis GN=cecr1 PE=1 SV=1 37 557 1.0E-61
sp|P58781|CEC1A_DANRE Adenosine deaminase CECR1-A OS=Danio rerio GN=cecr1a PE=2 SV=2 3 524 3.0E-60
sp|Q9NZK5|CECR1_HUMAN Adenosine deaminase CECR1 OS=Homo sapiens GN=CECR1 PE=1 SV=2 101 519 9.0E-60
sp|P58780|CECR1_PIG Adenosine deaminase CECR1 OS=Sus scrofa GN=CECR1 PE=2 SV=1 101 519 9.0E-60
sp|Q5RC46|CECR1_PONAB Adenosine deaminase CECR1 OS=Pongo abelii GN=CECR1 PE=2 SV=1 101 519 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2VQV9|CECR1_XENLA Adenosine deaminase CECR1 OS=Xenopus laevis GN=cecr1 PE=1 SV=1 37 557 1.0E-61
sp|P58781|CEC1A_DANRE Adenosine deaminase CECR1-A OS=Danio rerio GN=cecr1a PE=2 SV=2 3 524 3.0E-60
sp|Q9NZK5|CECR1_HUMAN Adenosine deaminase CECR1 OS=Homo sapiens GN=CECR1 PE=1 SV=2 101 519 9.0E-60
sp|P58780|CECR1_PIG Adenosine deaminase CECR1 OS=Sus scrofa GN=CECR1 PE=2 SV=1 101 519 9.0E-60
sp|Q5RC46|CECR1_PONAB Adenosine deaminase CECR1 OS=Pongo abelii GN=CECR1 PE=2 SV=1 101 519 2.0E-58
sp|P15287|AGSA_APLCA Adenosine deaminase AGSA OS=Aplysia californica PE=1 SV=2 92 557 1.0E-52
sp|Q553U5|CECR1_DICDI Adenosine deaminase CECR1 homolog OS=Dictyostelium discoideum GN=DDB_G0275179 PE=2 SV=1 63 567 1.0E-47
sp|Q4X1Q4|ADE_ASPFU Adenine deaminase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aah1 PE=3 SV=1 362 544 3.0E-15
sp|Q2TZN9|ADE_ASPOR Adenine deaminase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aah1 PE=3 SV=1 392 540 3.0E-14
sp|Q5NNW5|ADE_ZYMMO Adenine deaminase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO0971 PE=3 SV=1 392 534 1.0E-13
sp|Q82K09|MQNX_STRAW Aminodeoxyfutalosine deaminase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=add2 PE=1 SV=1 375 534 2.0E-13
sp|O86737|MQNX_STRCO Aminodeoxyfutalosine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5662 PE=1 SV=1 375 534 2.0E-13
sp|B3E600|ADE_GEOLS Adenine deaminase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=Glov_1001 PE=3 SV=1 412 534 3.0E-13
sp|Q9RDE5|ADE_STRCO Adenine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2546 PE=3 SV=1 392 530 5.0E-13
sp|Q839J4|ADD_ENTFA Adenosine deaminase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=add PE=3 SV=1 208 478 1.0E-12
sp|Q8X1T6|ADE_EMENI Adenine deaminase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aah1 PE=1 SV=1 362 532 3.0E-12
sp|Q6FCU0|ADE_ACIAD Adenine deaminase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD1245 PE=3 SV=1 412 534 3.0E-11
sp|Q11C48|ADE_CHESB Adenine deaminase OS=Chelativorans sp. (strain BNC1) GN=Meso_3659 PE=3 SV=1 312 479 3.0E-11
sp|Q9P6I7|ADE_SCHPO Adenine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=1 SV=1 356 503 2.0E-10
sp|Q8UJ05|ADE_AGRFC Adenine deaminase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu0136 PE=3 SV=1 344 479 2.0E-10
sp|Q7M9R5|ADE_WOLSU Adenine deaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=WS0737 PE=3 SV=1 392 533 4.0E-10
sp|B3W9T6|ADD_LACCB Adenosine deaminase OS=Lactobacillus casei (strain BL23) GN=add PE=3 SV=1 381 478 6.0E-10
sp|A5G460|ADE_GEOUR Adenine deaminase OS=Geobacter uraniireducens (strain Rf4) GN=Gura_2399 PE=3 SV=1 412 534 1.0E-09
sp|Q98GV2|ADE_RHILO Adenine deaminase OS=Rhizobium loti (strain MAFF303099) GN=mll3163 PE=3 SV=1 325 479 1.0E-09
sp|Q036B8|ADD_LACC3 Adenosine deaminase OS=Lactobacillus casei (strain ATCC 334) GN=add PE=3 SV=1 381 478 1.0E-09
sp|C1DGB0|ADE_AZOVD Adenine deaminase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=Avin_22300 PE=3 SV=1 412 483 2.0E-09
sp|B3PXN1|ADE_RHIE6 Adenine deaminase OS=Rhizobium etli (strain CIAT 652) GN=RHECIAT_CH0000242 PE=3 SV=1 350 479 2.0E-09
sp|P53984|ADDL_STRVG Putative adenosine/adenine deaminase OS=Streptomyces virginiae PE=3 SV=1 230 534 2.0E-09
sp|B9JYP8|ADE_AGRVS Adenine deaminase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=Avi_0230 PE=3 SV=1 350 479 3.0E-09
sp|B1WR40|ADE_CYAA5 Adenine deaminase OS=Cyanothece sp. (strain ATCC 51142) GN=cce_0747 PE=3 SV=1 412 519 4.0E-09
sp|Q6CM42|ADE_KLULA Adenine deaminase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAH1 PE=3 SV=1 380 483 5.0E-09
sp|A4VQI5|ADE_PSEU5 Adenine deaminase OS=Pseudomonas stutzeri (strain A1501) GN=PST_3608 PE=3 SV=1 412 483 5.0E-09
sp|Q8XXL5|ADE_RALSO Adenine deaminase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2098 PE=3 SV=1 392 540 5.0E-09
sp|A6T9W8|ADD_KLEP7 Adenosine deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=add PE=3 SV=1 413 509 6.0E-09
sp|Q7VNV1|ADD_HAEDU Adenosine deaminase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=add PE=3 SV=1 257 478 9.0E-09
sp|B5XWQ7|ADD_KLEP3 Adenosine deaminase OS=Klebsiella pneumoniae (strain 342) GN=add PE=3 SV=1 413 502 9.0E-09
sp|Q59ZB1|ADE_CANAL Adenine deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AAH1 PE=3 SV=1 392 499 1.0E-08
sp|Q97EV1|ADD_CLOAB Adenosine deaminase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=add PE=3 SV=1 251 534 2.0E-08
sp|B2U7U6|ADE_RALPJ Adenine deaminase OS=Ralstonia pickettii (strain 12J) GN=Rpic_2249 PE=3 SV=1 392 534 2.0E-08
sp|Q7MDL6|ADD_VIBVY Adenosine deaminase OS=Vibrio vulnificus (strain YJ016) GN=add PE=3 SV=1 209 501 3.0E-08
sp|Q2KDR5|ADE_RHIEC Adenine deaminase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH00197 PE=3 SV=1 350 479 3.0E-08
sp|B7URW2|ADD_ECO27 Adenosine deaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=add PE=3 SV=1 413 517 3.0E-08
sp|Q1RBH5|ADD_ECOUT Adenosine deaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=add PE=3 SV=1 413 517 3.0E-08
sp|Q8FH99|ADD_ECOL6 Adenosine deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=add PE=3 SV=1 413 517 3.0E-08
sp|Q0THK5|ADD_ECOL5 Adenosine deaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=add PE=3 SV=1 413 517 3.0E-08
sp|A1ABG8|ADD_ECOK1 Adenosine deaminase OS=Escherichia coli O1:K1 / APEC GN=add PE=3 SV=1 413 517 3.0E-08
sp|B7M9X6|ADD_ECO45 Adenosine deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=add PE=3 SV=1 413 517 3.0E-08
sp|Q8D6Q8|ADD_VIBVU Adenosine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=add PE=3 SV=1 209 501 4.0E-08
sp|B7MVA0|ADD_ECO81 Adenosine deaminase OS=Escherichia coli O81 (strain ED1a) GN=add PE=3 SV=1 413 517 4.0E-08
sp|Q2RWC5|ADE_RHORT Adenine deaminase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A0766 PE=3 SV=1 412 483 4.0E-08
sp|Q3B2Q0|ADE_CHLL7 Adenine deaminase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=Plut_1524 PE=3 SV=1 389 519 4.0E-08
sp|A6VWL7|ADE_MARMS Adenine deaminase OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_1922 PE=3 SV=1 413 524 4.0E-08
sp|A8GE12|ADD_SERP5 Adenosine deaminase OS=Serratia proteamaculans (strain 568) GN=add PE=3 SV=1 413 483 4.0E-08
sp|P53909|ADE_YEAST Adenine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAH1 PE=1 SV=1 379 524 5.0E-08
sp|Q87TF3|ADD_VIBPA Adenosine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=add PE=3 SV=1 383 483 5.0E-08
sp|Q7WBG5|ADE_BORPA Adenine deaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP1038 PE=3 SV=1 387 483 5.0E-08
sp|Q7WMY6|ADE_BORBR Adenine deaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB1254 PE=3 SV=1 387 483 5.0E-08
sp|Q9L0L6|ADDL_STRCO Putative adenosine/adenine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO4644 PE=3 SV=1 392 519 6.0E-08
sp|Q21T97|ADE_RHOFT Adenine deaminase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_3297 PE=3 SV=1 412 524 8.0E-08
sp|C3MBH4|ADE_RHISN Adenine deaminase OS=Rhizobium sp. (strain NGR234) GN=NGR_c34590 PE=3 SV=1 228 479 8.0E-08
sp|C5BDE0|ADD_EDWI9 Adenosine deaminase OS=Edwardsiella ictaluri (strain 93-146) GN=add PE=3 SV=1 413 517 9.0E-08
sp|A6UXT7|ADE_PSEA7 Adenine deaminase OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_0226 PE=3 SV=1 412 483 9.0E-08
sp|Q0KCW5|ADE_CUPNH Adenine deaminase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A1014 PE=3 SV=1 392 483 1.0E-07
sp|Q83RC0|ADD_SHIFL Adenosine deaminase OS=Shigella flexneri GN=add PE=3 SV=1 413 517 1.0E-07
sp|Q0T4F4|ADD_SHIF8 Adenosine deaminase OS=Shigella flexneri serotype 5b (strain 8401) GN=add PE=3 SV=1 413 517 1.0E-07
sp|Q02UT0|ADE_PSEAB Adenine deaminase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=PA14_01830 PE=3 SV=1 412 483 1.0E-07
sp|Q9I6Y4|ADE_PSEAE Adenine deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0148 PE=1 SV=1 412 483 1.0E-07
sp|B7V265|ADE_PSEA8 Adenine deaminase OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_01491 PE=3 SV=1 412 483 1.0E-07
sp|B5Z457|ADD_ECO5E Adenosine deaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=add PE=3 SV=1 413 517 1.0E-07
sp|Q8X661|ADD_ECO57 Adenosine deaminase OS=Escherichia coli O157:H7 GN=add PE=3 SV=1 413 517 1.0E-07
sp|Q3Z1X8|ADD_SHISS Adenosine deaminase OS=Shigella sonnei (strain Ss046) GN=add PE=3 SV=1 413 517 1.0E-07
sp|B4EVZ1|ADD_PROMH Adenosine deaminase OS=Proteus mirabilis (strain HI4320) GN=add PE=3 SV=1 413 483 1.0E-07
sp|B7NB76|ADD_ECOLU Adenosine deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=add PE=3 SV=1 413 517 1.0E-07
sp|P22333|ADD_ECOLI Adenosine deaminase OS=Escherichia coli (strain K12) GN=add PE=3 SV=2 413 517 1.0E-07
sp|B1IQD2|ADD_ECOLC Adenosine deaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=add PE=3 SV=1 413 517 1.0E-07
sp|A8A0G5|ADD_ECOHS Adenosine deaminase OS=Escherichia coli O9:H4 (strain HS) GN=add PE=3 SV=1 413 517 1.0E-07
sp|B1XF88|ADD_ECODH Adenosine deaminase OS=Escherichia coli (strain K12 / DH10B) GN=add PE=3 SV=1 413 517 1.0E-07
sp|C4ZY85|ADD_ECOBW Adenosine deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=add PE=3 SV=1 413 517 1.0E-07
sp|B7M0H9|ADD_ECO8A Adenosine deaminase OS=Escherichia coli O8 (strain IAI1) GN=add PE=3 SV=1 413 517 1.0E-07
sp|B7L5H5|ADD_ECO55 Adenosine deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=add PE=3 SV=1 413 517 1.0E-07
sp|A7ZM83|ADD_ECO24 Adenosine deaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=add PE=3 SV=1 413 517 1.0E-07
sp|B2VK11|ADD_ERWT9 Adenosine deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=add PE=3 SV=1 413 498 1.0E-07
sp|Q32FF0|ADD_SHIDS Adenosine deaminase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=add PE=3 SV=1 413 517 1.0E-07
sp|A1S1P1|ADD_SHEAM Adenosine deaminase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=add PE=3 SV=1 381 481 1.0E-07
sp|A0LRH8|MQNX_ACIC1 Aminodeoxyfutalosine deaminase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0264 PE=1 SV=1 380 493 1.0E-07
sp|B1LER3|ADD_ECOSM Adenosine deaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=add PE=3 SV=1 413 517 1.0E-07
sp|Q6D4X4|ADD_PECAS Adenosine deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=add PE=3 SV=1 413 483 2.0E-07
sp|B7NU11|ADD_ECO7I Adenosine deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=add PE=3 SV=1 413 517 2.0E-07
sp|B6IB57|ADD_ECOSE Adenosine deaminase OS=Escherichia coli (strain SE11) GN=add PE=3 SV=1 413 517 2.0E-07
sp|Q4ZYP1|ADE_PSEU2 Adenine deaminase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_0661 PE=3 SV=1 412 483 2.0E-07
sp|Q48D01|ADE_PSE14 Adenine deaminase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_4636 PE=3 SV=1 412 483 2.0E-07
sp|Q889J2|ADE_PSESM Adenine deaminase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_0757 PE=3 SV=1 412 483 2.0E-07
sp|C3K8W2|ADE_PSEFS Adenine deaminase OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_0667 PE=3 SV=1 412 483 2.0E-07
sp|A1JML4|ADD_YERE8 Adenosine deaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=add PE=3 SV=1 413 487 2.0E-07
sp|Q7N4H5|ADD_PHOLL Adenosine deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=add PE=3 SV=1 413 499 2.0E-07
sp|Q66AF0|ADD_YERPS Adenosine deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=add PE=3 SV=1 413 487 2.0E-07
sp|B2K4L5|ADD_YERPB Adenosine deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=add PE=3 SV=1 413 487 2.0E-07
sp|Q6FP78|ADE_CANGA Adenine deaminase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AAH1 PE=3 SV=1 380 534 2.0E-07
sp|B1JKL9|ADD_YERPY Adenosine deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=add PE=3 SV=1 413 487 2.0E-07
sp|A7FHX5|ADD_YERP3 Adenosine deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=add PE=3 SV=1 413 487 2.0E-07
sp|B4T5A0|ADD_SALNS Adenosine deaminase OS=Salmonella newport (strain SL254) GN=add PE=3 SV=1 413 502 3.0E-07
sp|B5QUG0|ADD_SALEP Adenosine deaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=add PE=3 SV=1 413 502 3.0E-07
sp|Q1LQ00|ADE_CUPMC Adenine deaminase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0890 PE=3 SV=1 392 534 3.0E-07
sp|Q46YJ3|ADE_CUPPJ Adenine deaminase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2428 PE=3 SV=1 392 483 4.0E-07
sp|B9J6V8|ADE_AGRRK Adenine deaminase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=Arad_0352 PE=3 SV=1 330 479 4.0E-07
sp|B5RAJ6|ADD_SALG2 Adenosine deaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=add PE=3 SV=1 413 502 4.0E-07
sp|B1KHA6|ADD_SHEWM Adenosine deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=add PE=3 SV=1 356 478 4.0E-07
sp|A4W9X4|ADD_ENT38 Adenosine deaminase OS=Enterobacter sp. (strain 638) GN=add PE=3 SV=1 413 485 4.0E-07
sp|Q4KIS2|ADE_PSEF5 Adenine deaminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_0719 PE=3 SV=1 412 483 4.0E-07
sp|B5ZXI3|ADE_RHILW Adenine deaminase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=Rleg2_4180 PE=3 SV=1 350 479 4.0E-07
sp|A3QJD9|ADD_SHELP Adenosine deaminase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=add PE=3 SV=1 413 508 5.0E-07
sp|Q320Y0|ADD_SHIBS Adenosine deaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=add PE=3 SV=1 413 517 5.0E-07
sp|B2U2C1|ADD_SHIB3 Adenosine deaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=add PE=3 SV=1 413 517 5.0E-07
sp|B0KLE3|ADE_PSEPG Adenine deaminase OS=Pseudomonas putida (strain GB-1) GN=PputGB1_0636 PE=3 SV=1 412 483 5.0E-07
sp|Q13V90|ADE_BURXL Adenine deaminase OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A3461 PE=3 SV=1 380 483 5.0E-07
sp|Q20YN2|ADE_RHOPB Adenine deaminase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_4230 PE=3 SV=1 412 483 6.0E-07
sp|C3LSH8|ADD_VIBCM Adenosine deaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=add PE=3 SV=1 413 493 6.0E-07
sp|Q9KNI7|ADD_VIBCH Adenosine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=add PE=3 SV=1 413 493 6.0E-07
sp|A5F4Q2|ADD_VIBC3 Adenosine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=add PE=3 SV=1 413 493 6.0E-07
sp|Q8DTN8|ADD_STRMU Adenosine deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=add PE=3 SV=1 388 478 6.0E-07
sp|Q08A11|ADD_SHEFN Adenosine deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=add PE=3 SV=1 412 523 7.0E-07
sp|Q12I24|ADD_SHEDO Adenosine deaminase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=add PE=3 SV=1 392 523 8.0E-07
sp|Q3IF68|ADD_PSEHT Adenosine deaminase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=add PE=3 SV=1 391 483 8.0E-07
sp|B5FIE1|ADD_SALDC Adenosine deaminase OS=Salmonella dublin (strain CT_02021853) GN=add PE=3 SV=1 413 502 8.0E-07
sp|Q8Z6R2|ADD_SALTI Adenosine deaminase OS=Salmonella typhi GN=add PE=3 SV=1 413 502 9.0E-07
sp|B4THP5|ADD_SALHS Adenosine deaminase OS=Salmonella heidelberg (strain SL476) GN=add PE=3 SV=1 413 502 9.0E-07
sp|B5F6I4|ADD_SALA4 Adenosine deaminase OS=Salmonella agona (strain SL483) GN=add PE=3 SV=1 413 502 9.0E-07
sp|Q8ZPL9|ADD_SALTY Adenosine deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=add PE=3 SV=1 413 502 9.0E-07
sp|B4TVC7|ADD_SALSV Adenosine deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=add PE=3 SV=1 413 502 9.0E-07
sp|C0Q502|ADD_SALPC Adenosine deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=add PE=3 SV=1 413 502 9.0E-07
sp|B3R3T1|ADE_CUPTR Adenine deaminase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A0998 PE=3 SV=1 392 483 1.0E-06
sp|B2T672|ADE_BURPP Adenine deaminase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_3044 PE=3 SV=1 380 483 1.0E-06
sp|B1JFB0|ADE_PSEPW Adenine deaminase OS=Pseudomonas putida (strain W619) GN=PputW619_4572 PE=3 SV=1 412 483 1.0E-06
sp|Q88QA3|ADE_PSEPK Adenine deaminase OS=Pseudomonas putida (strain KT2440) GN=PP_0591 PE=3 SV=1 412 483 1.0E-06
sp|C6DH28|ADD_PECCP Adenosine deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=add PE=3 SV=1 413 483 1.0E-06
sp|Q1MMV7|ADE_RHIL3 Adenine deaminase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL0206 PE=3 SV=1 350 479 2.0E-06
sp|Q1GRK2|ADE_SPHAL Adenine deaminase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=Sala_2009 PE=3 SV=1 412 534 2.0E-06
sp|B1ZYW1|ADDL_OPITP Putative adenosine/adenine deaminase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=Oter_3003 PE=3 SV=1 413 514 2.0E-06
sp|Q1IFE4|ADE_PSEE4 Adenine deaminase OS=Pseudomonas entomophila (strain L48) GN=PSEEN0674 PE=3 SV=1 412 516 2.0E-06
sp|Q0HD92|ADD_SHESM Adenosine deaminase OS=Shewanella sp. (strain MR-4) GN=add PE=3 SV=1 413 485 2.0E-06
sp|A0L2R5|ADD_SHESA Adenosine deaminase OS=Shewanella sp. (strain ANA-3) GN=add PE=3 SV=1 413 485 2.0E-06
sp|Q1QDL4|ADE_PSYCK Adenine deaminase OS=Psychrobacter cryohalolentis (strain K5) GN=Pcryo_0456 PE=3 SV=1 392 536 2.0E-06
sp|B5FFC4|ADD_VIBFM Adenosine deaminase OS=Vibrio fischeri (strain MJ11) GN=add PE=3 SV=1 413 483 2.0E-06
sp|Q2SLW3|ADE_HAHCH Adenine deaminase OS=Hahella chejuensis (strain KCTC 2396) GN=HCH_01503 PE=3 SV=1 412 540 2.0E-06
sp|Q3KIJ1|ADE_PSEPF Adenine deaminase OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_0671 PE=3 SV=1 412 483 2.0E-06
sp|Q5E8Q8|ADD_VIBF1 Adenosine deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=add PE=3 SV=2 413 483 3.0E-06
sp|A4YCD7|ADD_SHEPC Adenosine deaminase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=add PE=3 SV=1 413 485 3.0E-06
sp|Q0HPH4|ADD_SHESR Adenosine deaminase OS=Shewanella sp. (strain MR-7) GN=add PE=3 SV=1 413 485 6.0E-06
sp|A1RDZ6|ADD_SHESW Adenosine deaminase OS=Shewanella sp. (strain W3-18-1) GN=add PE=3 SV=1 413 485 7.0E-06
sp|Q8E8D4|ADD_SHEON Adenosine deaminase OS=Shewanella oneidensis (strain MR-1) GN=add PE=3 SV=1 413 485 7.0E-06
sp|B8EDT7|ADD_SHEB2 Adenosine deaminase OS=Shewanella baltica (strain OS223) GN=add PE=3 SV=1 413 485 8.0E-06
sp|A6WUH7|ADD_SHEB8 Adenosine deaminase OS=Shewanella baltica (strain OS185) GN=add PE=3 SV=1 413 485 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019239 deaminase activity Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3915
MRLSGLLTSFVLIFTVRSWNPIPNANSQVVTKHILAREAMIKIEERQRQDQDFRQRLSPVAAQADAIVGKIRQYE
IRHFWQQETDSEARFAGAMFPLVRPLITKTRLWTIVQRMPKGALLHAHLKAMLPYGVLLEAIFHTPGMAVSASQS
LDTEEARRNASIAFSHINTTVAGSFAITSPEYVPGTPVFVKATASSFPGGKDGFMRYAMSKLVISPEQATQHELG
VNQVWRRFQALFGTAGTLLSYEPIVRTFYRQLFSRLVDDGVYWVEIRAGGSQGKLVHSGEQDVDSDLDVWWEVME
DEMEKFKATDKGKRFWGARVIWSDFRGKDRTSLTNSMKMALERKVKFPQLFSGYDVVAQEDLGRSLSDMTPELLW
FQNEATALNVSVPFFFHAGETLGDGNSTDSNLVDALLLGTRRIGHGFSLYKHPKLMEKAIEKAVMVEVCPISNEV
LRLATDILHHPLPALVAHGVPTSINNDDPAMLGQDAAGLSYDFYQVIQAFDNVGLAGLGALAHNSLRWSHFEDQS
DADWRRDIDLAEQGHGIKARRLQEWNSQWEEFCHWIVTEFGS
Coding >Ophio5|3915
ATGCGTCTCTCCGGCCTCCTGACAAGTTTTGTCCTAATCTTCACTGTCAGGTCATGGAACCCCATCCCTAATGCC
AACAGCCAAGTCGTGACGAAGCATATCCTAGCTCGGGAAGCCATGATCAAGATCGAGGAGAGGCAGCGACAAGAC
CAAGACTTCCGGCAGCGACTGTCCCCTGTAGCCGCGCAGGCGGATGCCATCGTCGGCAAGATTCGGCAGTATGAG
ATTCGACACTTTTGGCAGCAGGAGACGGACTCGGAGGCGAGATTCGCCGGCGCCATGTTTCCCCTTGTCCGCCCC
TTGATCACCAAGACCAGGCTGTGGACCATTGTCCAGCGGATGCCGAAAGGCGCCTTGCTGCACGCCCACCTCAAG
GCCATGCTGCCGTATGGAGTCCTACTCGAGGCAATCTTCCACACGCCCGGAATGGCCGTCTCGGCCTCTCAAAGC
CTAGATACGGAGGAAGCACGCCGTAACGCGTCCATCGCCTTCTCCCACATAAACACCACCGTCGCAGGTAGCTTC
GCCATTACTTCCCCCGAATACGTCCCTGGCACGCCAGTCTTCGTCAAGGCCACGGCTTCCAGTTTTCCCGGTGGC
AAAGACGGCTTCATGCGATACGCCATGTCCAAGCTGGTCATCTCGCCCGAACAAGCGACGCAGCACGAACTCGGT
GTGAATCAGGTATGGCGCCGTTTTCAAGCCTTGTTTGGTACGGCCGGCACTCTGCTGTCATACGAGCCTATTGTC
CGCACCTTCTACCGTCAGCTTTTCAGCCGGCTCGTAGACGATGGCGTCTACTGGGTCGAGATCCGTGCCGGGGGA
TCCCAAGGCAAGCTGGTCCATTCCGGTGAGCAAGACGTCGACTCGGACCTGGATGTCTGGTGGGAAGTGATGGAG
GACGAGATGGAAAAGTTCAAGGCAACCGACAAAGGAAAGCGATTTTGGGGAGCCAGGGTGATTTGGTCCGACTTT
CGGGGCAAGGACCGGACGTCACTTACCAATAGCATGAAGATGGCGTTAGAGAGAAAGGTCAAGTTCCCTCAGCTT
TTCAGCGGATACGATGTCGTTGCCCAGGAGGATCTTGGTCGTAGCCTATCGGATATGACGCCCGAGTTGCTCTGG
TTCCAGAACGAGGCGACCGCCCTCAACGTCTCCGTCCCCTTCTTTTTCCACGCCGGCGAGACTCTCGGCGACGGG
AACTCGACCGACTCGAACCTGGTTGACGCTCTATTGCTCGGCACGCGGCGTATTGGCCACGGCTTCTCCCTCTAT
AAGCATCCCAAGTTGATGGAAAAGGCCATCGAGAAGGCGGTCATGGTCGAGGTCTGCCCCATCTCTAATGAAGTT
CTTCGCCTGGCAACAGACATCCTTCACCACCCGCTGCCGGCTCTGGTTGCTCATGGGGTGCCCACCTCCATCAAC
AATGATGACCCGGCGATGCTCGGCCAGGACGCGGCCGGCCTGAGTTATGACTTCTATCAGGTGATCCAGGCCTTT
GATAATGTCGGCTTGGCTGGTCTGGGTGCTCTAGCACACAATAGCTTGCGCTGGTCTCACTTCGAAGATCAGTCC
GATGCCGACTGGAGGAGAGACATTGACTTGGCGGAGCAGGGGCATGGCATCAAGGCCAGGCGTCTTCAGGAGTGG
AACAGTCAGTGGGAGGAGTTTTGTCACTGGATTGTGACGGAGTTTGGGTCA
Transcript >Ophio5|3915
ATGCGTCTCTCCGGCCTCCTGACAAGTTTTGTCCTAATCTTCACTGTCAGGTCATGGAACCCCATCCCTAATGCC
AACAGCCAAGTCGTGACGAAGCATATCCTAGCTCGGGAAGCCATGATCAAGATCGAGGAGAGGCAGCGACAAGAC
CAAGACTTCCGGCAGCGACTGTCCCCTGTAGCCGCGCAGGCGGATGCCATCGTCGGCAAGATTCGGCAGTATGAG
ATTCGACACTTTTGGCAGCAGGAGACGGACTCGGAGGCGAGATTCGCCGGCGCCATGTTTCCCCTTGTCCGCCCC
TTGATCACCAAGACCAGGCTGTGGACCATTGTCCAGCGGATGCCGAAAGGCGCCTTGCTGCACGCCCACCTCAAG
GCCATGCTGCCGTATGGAGTCCTACTCGAGGCAATCTTCCACACGCCCGGAATGGCCGTCTCGGCCTCTCAAAGC
CTAGATACGGAGGAAGCACGCCGTAACGCGTCCATCGCCTTCTCCCACATAAACACCACCGTCGCAGGTAGCTTC
GCCATTACTTCCCCCGAATACGTCCCTGGCACGCCAGTCTTCGTCAAGGCCACGGCTTCCAGTTTTCCCGGTGGC
AAAGACGGCTTCATGCGATACGCCATGTCCAAGCTGGTCATCTCGCCCGAACAAGCGACGCAGCACGAACTCGGT
GTGAATCAGGTATGGCGCCGTTTTCAAGCCTTGTTTGGTACGGCCGGCACTCTGCTGTCATACGAGCCTATTGTC
CGCACCTTCTACCGTCAGCTTTTCAGCCGGCTCGTAGACGATGGCGTCTACTGGGTCGAGATCCGTGCCGGGGGA
TCCCAAGGCAAGCTGGTCCATTCCGGTGAGCAAGACGTCGACTCGGACCTGGATGTCTGGTGGGAAGTGATGGAG
GACGAGATGGAAAAGTTCAAGGCAACCGACAAAGGAAAGCGATTTTGGGGAGCCAGGGTGATTTGGTCCGACTTT
CGGGGCAAGGACCGGACGTCACTTACCAATAGCATGAAGATGGCGTTAGAGAGAAAGGTCAAGTTCCCTCAGCTT
TTCAGCGGATACGATGTCGTTGCCCAGGAGGATCTTGGTCGTAGCCTATCGGATATGACGCCCGAGTTGCTCTGG
TTCCAGAACGAGGCGACCGCCCTCAACGTCTCCGTCCCCTTCTTTTTCCACGCCGGCGAGACTCTCGGCGACGGG
AACTCGACCGACTCGAACCTGGTTGACGCTCTATTGCTCGGCACGCGGCGTATTGGCCACGGCTTCTCCCTCTAT
AAGCATCCCAAGTTGATGGAAAAGGCCATCGAGAAGGCGGTCATGGTCGAGGTCTGCCCCATCTCTAATGAAGTT
CTTCGCCTGGCAACAGACATCCTTCACCACCCGCTGCCGGCTCTGGTTGCTCATGGGGTGCCCACCTCCATCAAC
AATGATGACCCGGCGATGCTCGGCCAGGACGCGGCCGGCCTGAGTTATGACTTCTATCAGGTGATCCAGGCCTTT
GATAATGTCGGCTTGGCTGGTCTGGGTGCTCTAGCACACAATAGCTTGCGCTGGTCTCACTTCGAAGATCAGTCC
GATGCCGACTGGAGGAGAGACATTGACTTGGCGGAGCAGGGGCATGGCATCAAGGCCAGGCGTCTTCAGGAGTGG
AACAGTCAGTGGGAGGAGTTTTGTCACTGGATTGTGACGGAGTTTGGGTCATGA
Gene >Ophio5|3915
ATGCGTCTCTCCGGCCTCCTGACAAGTTTTGTCCTAATCTTCACTGTCAGGTCATGGAACCCCATCCCTAATGCC
AACAGCCAAGTCGTGACGAAGCATATCCTAGCTCGGGAAGCCATGATCAAGATCGAGGAGAGGCAGCGACAAGGT
GGTTTCCCTTGTCGACGATGCCTGGTCGTCACCGCTGAACGCGATGCCCGCAGACCAAGACTTCCGGCAGCGACT
GTCCCCTGTAGCCGCGCAGGCGGATGCCATCGTCGGCAAGATTCGGCAGTATGAGATTCGACACTTTTGGCAGCA
GGAGACGGACTCGGAGGCGAGATTCGCCGGCGCCATGTTTCCCCTTGTCCGCCCCTTGATCACCAAGACCAGGCT
GTGGACCATTGTCCAGCGGATGCCGAAAGGCGCCTTGCTGCACGCCCACCTCAAGGCCATGCTGCCGTATGGAGT
CCTACTCGAGGCAATCTTCCACACGCCCGGAATGGCCGTCTCGGCCTCTCAAAGCCTAGATACGGAGGAAGCACG
CCGTAACGCGTCCATCGCCTTCTCCCACATAAACACCACCGTCGCAGGTAGCTTCGCCATTACTTCCCCCGAATA
CGTCCCTGGCACGCCAGTCTTCGTCAAGGCCACGGCTTCCAGTTTTCCCGGTGGCAAAGACGGCTTCATGCGATA
CGCCATGTCCAAGCTGGTCATCTCGCCCGAACAAGCGACGCAGCACGAACTCGGTGTGAATCAGGTATGGCGCCG
TTTTCAAGCCTTGTTTGGTACGGCCGGCACTCTGCTGTCATACGAGCCTATTGTCCGCACCTTCTACCGTCAGCT
TTTCAGCCGGCTCGTAGACGATGGCGTCTACTGGGTCGAGATCCGTGCCGGGGGATCCCAAGGCAAGCTGGTCCA
TTCCGGTGAGCAAGACGTCGACTCGGACCTGGATGTCTGGTGGGAAGTGATGGAGGACGAGATGGAAAAGTTCAA
GGCAACCGACAAAGGAAAGCGATTTTGGGGAGCCAGGGTGATTTGGTCCGACTTTCGGGGCAAGGACCGGACGTC
ACTTACCAATAGTCAGTCCAGACACTATGCCTCGGAGGCTTTTTGCTGACCTTGATATGCTGCAGGCATGAAGAT
GGCGTTAGAGAGAAAGGTCAAGTTCCCTCAGCTTTTCAGCGGATACGATGTCGTTGCCCAGGAGGATCTTGGTCG
TAGCCTATCGGATATGACGCCCGAGTTGCTCTGGTTCCAGAACGAGGCGACCGCCCTCAACGTCTCCGTCCCCTT
CTTTTTCCACGCCGGCGAGACTCTCGGCGACGGGAACTCGACCGACTCGAACCTGGTTGACGCTCTATTGCTCGG
CACGCGGCGTATTGGCCACGGCTTCTCCCTCTATAAGCATCCCAAGTTGATGGAAAAGGCCATCGAGAAGGCGGT
CATGGTCGAGGTCTGCCCCATCTCTAATGAAGTTCTTCGCCTGGCAACAGACATCCTTCACCACCCGCTGCCGGC
TCTGGTTGCTCATGGGGTGCCCACCTCCATCAACAATGATGACCCGGCGATGCTCGGCCAGGACGCGGCCGGCCT
GAGTTATGACTTCTATCAGGTGATCCAGGCCTTTGATAATGTCGGCTTGGCTGGTCTGGTGCGTCTGGACTCGAG
ACGTGCGCGCGCAGAGTCCGGTTGCTAACATTTAGGCCCATAGGGTGCTCTAGCACACAATAGCTTGCGCTGGTC
TCACTTCGAAGATCAGTCCGATGCCGACTGGAGGAGAGACATTGACTTGGCGGAGCAGGGGCATGGCATCAAGGC
CAGGCGTCTTCAGGAGTGGAACAGTCAGTGGGAGGAGTTTTGTCACTGGATTGTGACGGAGTTTGGGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail