Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|391
Gene name
Locationscaffold_1092:1093..2840
Strand-
Gene length (bp)1747
Transcript length (bp)1362
Coding sequence length (bp)1359
Protein length (aa) 453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7991 0.3156 0.222 0.2162 0.0987 0.012 0.2381 0.0938 0.1357 0.0552

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2500
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1502
Ophiocordyceps australis map64 (Brazil) OphauB2|756
Ophiocordyceps camponoti-floridani Ophcf2|06024
Ophiocordyceps camponoti-rufipedis Ophun1|6835
Ophiocordyceps kimflemingae Ophio5|391 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3623

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|391
MDPTTTLITFLLQTDPSIQSVNLIGSWDGFSTCYPMKPDVRRGRGQWRGCYSFKDIICDDEAAVTRRDGGLKMGA
TYYYYYEVDGSVETFDPVEPSTTACPYLPGQTVNTLSVPVERSERHRSASLNSLHADRFKTMDPDAKFATPCPPA
APPATEAAASRRLASAPGLHRARMPAPPASWKRLFSRKLSGRGPDDGAGSSPTDAGGSIAPPVASRARDISPESL
RRFLSNDGACRLEPARPHPGLVIPEDIVEEADDDDYDYDDDDNDNDNFATSPLPEKQLYATSLSPPPIRRYPSSD
AMANASSLTLKAAPPPSVPPAASLPRVEASSRPMCWSISATSSGLTWQSVEDDPPSFYDSYDEDDVMSSNDGDNF
SHAPLPSLSSSAERAFKVYSLPRQADEVKGDSIASPRSPRLLARSDSTGGAANLLGADTGLDDLVSELGWMVDVI
GNK
Coding >Ophio5|391
ATGGATCCTACTACCACTCTCATAACCTTTCTCCTTCAGACGGATCCCTCGATCCAGTCCGTCAACCTCATTGGC
TCCTGGGACGGCTTTTCCACCTGCTACCCCATGAAGCCCGACGTCCGTCGCGGCCGGGGCCAGTGGAGGGGGTGT
TATTCCTTCAAAGACATTATTTGCGATGACGAGGCCGCCGTGACCCGTCGCGACGGTGGACTCAAGATGGGCGCC
ACCTACTATTACTACTACGAGGTGGATGGTTCTGTCGAGACGTTTGACCCCGTCGAGCCCTCGACTACCGCCTGT
CCCTATCTCCCCGGCCAGACGGTCAACACGCTGAGCGTCCCCGTCGAGCGCTCAGAGCGCCACCGCAGCGCCTCC
CTCAACTCCTTGCACGCCGACCGCTTCAAGACGATGGATCCGGACGCCAAGTTCGCTACGCCCTGTCCGCCCGCC
GCTCCTCCTGCCACCGAGGCGGCCGCCTCCCGCCGACTGGCCTCGGCCCCAGGCCTCCACCGCGCCCGTATGCCC
GCTCCGCCCGCGTCGTGGAAGCGCCTCTTCAGCCGCAAGCTGTCCGGCCGCGGACCCGATGACGGCGCCGGATCC
TCGCCGACTGACGCGGGCGGCTCGATTGCTCCCCCTGTGGCCAGCCGCGCCCGGGACATTTCGCCCGAGTCGTTG
CGCCGTTTCCTCTCCAACGATGGCGCATGCCGACTCGAACCGGCTCGCCCGCACCCGGGCCTGGTGATACCCGAG
GACATCGTCGAGGAGGCCGATGACGACGATTACGACTATGACGACGACGACAACGACAACGACAACTTTGCCACG
TCGCCGCTGCCGGAGAAGCAGCTCTACGCCACGTCTCTGTCTCCGCCTCCTATCCGACGCTACCCATCGTCAGAC
GCCATGGCCAATGCCAGCTCCCTTACGCTCAAGGCAGCCCCGCCCCCGAGCGTGCCACCTGCCGCCTCCTTGCCT
AGGGTGGAAGCAAGCTCGCGGCCGATGTGCTGGTCCATTTCGGCCACGTCGAGCGGCTTGACGTGGCAGTCGGTC
GAGGACGACCCCCCATCGTTTTACGACTCATACGACGAGGACGATGTCATGTCGAGCAATGACGGCGACAACTTT
TCGCACGCTCCGCTACCGAGCCTGTCGTCGTCGGCCGAGCGGGCCTTTAAGGTTTACAGCCTGCCACGACAGGCC
GACGAGGTCAAGGGCGACAGCATCGCTAGCCCGCGCTCCCCGCGCCTCCTAGCCCGAAGCGATTCGACGGGCGGG
GCCGCCAATCTACTGGGCGCCGACACTGGCTTGGATGACCTGGTCAGCGAGCTCGGCTGGATGGTCGACGTCATT
GGCAACAAG
Transcript >Ophio5|391
ATGGATCCTACTACCACTCTCATAACCTTTCTCCTTCAGACGGATCCCTCGATCCAGTCCGTCAACCTCATTGGC
TCCTGGGACGGCTTTTCCACCTGCTACCCCATGAAGCCCGACGTCCGTCGCGGCCGGGGCCAGTGGAGGGGGTGT
TATTCCTTCAAAGACATTATTTGCGATGACGAGGCCGCCGTGACCCGTCGCGACGGTGGACTCAAGATGGGCGCC
ACCTACTATTACTACTACGAGGTGGATGGTTCTGTCGAGACGTTTGACCCCGTCGAGCCCTCGACTACCGCCTGT
CCCTATCTCCCCGGCCAGACGGTCAACACGCTGAGCGTCCCCGTCGAGCGCTCAGAGCGCCACCGCAGCGCCTCC
CTCAACTCCTTGCACGCCGACCGCTTCAAGACGATGGATCCGGACGCCAAGTTCGCTACGCCCTGTCCGCCCGCC
GCTCCTCCTGCCACCGAGGCGGCCGCCTCCCGCCGACTGGCCTCGGCCCCAGGCCTCCACCGCGCCCGTATGCCC
GCTCCGCCCGCGTCGTGGAAGCGCCTCTTCAGCCGCAAGCTGTCCGGCCGCGGACCCGATGACGGCGCCGGATCC
TCGCCGACTGACGCGGGCGGCTCGATTGCTCCCCCTGTGGCCAGCCGCGCCCGGGACATTTCGCCCGAGTCGTTG
CGCCGTTTCCTCTCCAACGATGGCGCATGCCGACTCGAACCGGCTCGCCCGCACCCGGGCCTGGTGATACCCGAG
GACATCGTCGAGGAGGCCGATGACGACGATTACGACTATGACGACGACGACAACGACAACGACAACTTTGCCACG
TCGCCGCTGCCGGAGAAGCAGCTCTACGCCACGTCTCTGTCTCCGCCTCCTATCCGACGCTACCCATCGTCAGAC
GCCATGGCCAATGCCAGCTCCCTTACGCTCAAGGCAGCCCCGCCCCCGAGCGTGCCACCTGCCGCCTCCTTGCCT
AGGGTGGAAGCAAGCTCGCGGCCGATGTGCTGGTCCATTTCGGCCACGTCGAGCGGCTTGACGTGGCAGTCGGTC
GAGGACGACCCCCCATCGTTTTACGACTCATACGACGAGGACGATGTCATGTCGAGCAATGACGGCGACAACTTT
TCGCACGCTCCGCTACCGAGCCTGTCGTCGTCGGCCGAGCGGGCCTTTAAGGTTTACAGCCTGCCACGACAGGCC
GACGAGGTCAAGGGCGACAGCATCGCTAGCCCGCGCTCCCCGCGCCTCCTAGCCCGAAGCGATTCGACGGGCGGG
GCCGCCAATCTACTGGGCGCCGACACTGGCTTGGATGACCTGGTCAGCGAGCTCGGCTGGATGGTCGACGTCATT
GGCAACAAGTGA
Gene >Ophio5|391
ATGGATCCTACTACCACTCTCATAACCTTTCTCCTGTAAGCTTTCTCTCCTTTCTTTCCCCTCTCTTCTCTTTCT
TCTACCCAGCACACTTCACGTCGAGATGAAGACGGAGAAACAAAAAAAAAGAGGAAACAAAACAAAGAACTGTTC
GTCGAAACAAGGATAACCTCGTCTCGCTCCTTCATTGGCTCTCAATATCATCGGCCTCGTTTCACTTGGTGTCTT
TGCCGCCCCTCCTCCTCCGTCACCATTGCTCCTGCGGCTGAGGCACCGCGTCCAATGGCCGGCTTTTGCTCGTCA
CATCGCGGCCACGTCGCGAGCCGCTATCGACGACCGCCAAACTTCAGCTGACGCTCTGCTCCCGACAGTCAGACG
GATCCCTCGATCCAGTCCGTCAACCTCATTGGCTCCTGGGACGGCTTTTCCACCTGCTACCCCATGAAGCCCGAC
GTCCGTCGCGGCCGGGGCCAGTGGAGGGGGTGTTATTCCTTCAAAGACATTATTTGCGATGACGAGGCCGCCGTG
ACCCGTCGCGACGGTGGACTCAAGATGGGCGCCACCTACTATTACTACGTGAGTCTTCCCGAGAGTCGACATGTC
CCGTCTTGCTGATGCGTCTTTCCAGTACGAGGTGGATGGTTCTGTCGAGACGTTTGACCCCGTCGAGCCCTCGAC
TACCGCCTGTCCCTATCTCCCCGGCCAGACGGTCAACACGCTGAGCGTCCCCGTCGAGCGCTCAGAGCGCCACCG
CAGCGCCTCCCTCAACTCCTTGCACGCCGACCGCTTCAAGACGATGGATCCGGACGCCAAGTTCGCTACGCCCTG
TCCGCCCGCCGCTCCTCCTGCCACCGAGGCGGCCGCCTCCCGCCGACTGGCCTCGGCCCCAGGCCTCCACCGCGC
CCGTATGCCCGCTCCGCCCGCGTCGTGGAAGCGCCTCTTCAGCCGCAAGCTGTCCGGCCGCGGACCCGATGACGG
CGCCGGATCCTCGCCGACTGACGCGGGCGGCTCGATTGCTCCCCCTGTGGCCAGCCGCGCCCGGGACATTTCGCC
CGAGTCGTTGCGCCGTTTCCTCTCCAACGATGGCGCATGCCGACTCGAACCGGCTCGCCCGCACCCGGGCCTGGT
GATACCCGAGGACATCGTCGAGGAGGCCGATGACGACGATTACGACTATGACGACGACGACAACGACAACGACAA
CTTTGCCACGTCGCCGCTGCCGGAGAAGCAGCTCTACGCCACGTCTCTGTCTCCGCCTCCTATCCGACGCTACCC
ATCGTCAGACGCCATGGCCAATGCCAGCTCCCTTACGCTCAAGGCAGCCCCGCCCCCGAGCGTGCCACCTGCCGC
CTCCTTGCCTAGGGTGGAAGCAAGCTCGCGGCCGATGTGCTGGTCCATTTCGGCCACGTCGAGCGGCTTGACGTG
GCAGTCGGTCGAGGACGACCCCCCATCGTTTTACGACTCATACGACGAGGACGATGTCATGTCGAGCAATGACGG
CGACAACTTTTCGCACGCTCCGCTACCGAGCCTGTCGTCGTCGGCCGAGCGGGCCTTTAAGGTTTACAGCCTGCC
ACGACAGGCCGACGAGGTCAAGGGCGACAGCATCGCTAGCCCGCGCTCCCCGCGCCTCCTAGCCCGAAGCGATTC
GACGGGCGGGGCCGCCAATCTACTGGGCGCCGACACTGGCTTGGATGACCTGGTCAGCGAGCTCGGCTGGATGGT
CGACGTCATTGGCAACAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail