Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3906
Gene name
Locationscaffold_305:228..2183
Strand-
Gene length (bp)1955
Transcript length (bp)1635
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.4E-10 71 240
PF01494 FAD_binding_3 FAD binding domain 6.7E-09 365 426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 69 453 3.0E-41
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 90 451 6.0E-33
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 90 431 4.0E-31
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 90 431 6.0E-31
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 68 442 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 69 453 3.0E-41
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 90 451 6.0E-33
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 90 431 4.0E-31
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 90 431 6.0E-31
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 68 442 3.0E-28
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 93 442 1.0E-27
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 82 422 2.0E-26
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 68 420 2.0E-23
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 68 420 3.0E-23
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 92 396 4.0E-23
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 164 420 6.0E-22
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 68 431 4.0E-21
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 68 431 9.0E-21
sp|B2FL98|KMO_STRMK Kynurenine 3-monooxygenase OS=Stenotrophomonas maltophilia (strain K279a) GN=kmo PE=3 SV=1 70 428 7.0E-17
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 80 403 8.0E-17
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 68 421 3.0E-13
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 84 433 3.0E-13
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 57 411 7.0E-13
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 69 399 1.0E-12
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 68 399 1.0E-09
sp|Q3BV41|KMO_XANC5 Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=kmo PE=3 SV=1 67 399 7.0E-09
sp|Q8PAD3|KMO_XANCP Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kmo PE=3 SV=1 64 399 6.0E-08
sp|Q4UT92|KMO_XANC8 Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=kmo PE=3 SV=1 64 399 6.0E-08
sp|Q8PM34|KMO_XANAC Kynurenine 3-monooxygenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kmo PE=3 SV=1 70 399 1.0E-07
sp|Q2P316|KMO_XANOM Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=kmo PE=3 SV=1 67 399 3.0E-07
sp|B0RV00|KMO_XANCB Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=kmo PE=3 SV=1 64 399 3.0E-07
sp|Q5H038|KMO_XANOR Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=kmo PE=3 SV=1 67 399 4.0E-07
sp|B2SIT6|KMO_XANOP Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=kmo PE=3 SV=2 67 399 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 31 48 17
2 68 90 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3906
MCLLVRPSSLPSFVEPQPDIRDSFWHLVPPTFSHHLVFVVVVLLFALAMHSDAASLPSFASRRASHPIRLVIAGA
GIAGLATGLGLGLTGHDVTILEQASNLDEAGAGIQIAPNATRVLARLGVLDQVLQDADPLERISIRRYADDEELG
SASIMPGAARRYGAPALVIHRGDLHRILLTAARRAGCRILTGRRVVGIEPGPPPRIQTSDGDWHQGDVVLGADGV
RSVLRAYVTTSNGESDSSLGLKPTGDAAYRMLIPRERLAGHETLGALVDGRDTMRWLGPRGHVMAYPVRHQALYN
VVILHPIDSPAVASSAVNGQVRRPKSDAVDFCRDWCRPVRDLVACMPDGDVVTEWLLYTHPPLPRWTRGRVALVG
DACHPMLPYTAQGAACAIEDAGALVAAFACGLSPDAALALYQRVRKPGSESVQAASARQRACLHLPDGATQARRD
DAIRRALAAPPDDGVAPLLPNPDLWVDRRWQDRVWGSDVVYDVFQACIRETVWPLSTSLRCVLPLSSSSSGGGGI
APEPDGVAEYRQRGRASQP
Coding >Ophio5|3906
ATGTGCCTCCTCGTTCGACCATCTTCTCTTCCGTCCTTCGTCGAGCCTCAACCCGACATACGAGACTCCTTTTGG
CATCTGGTGCCGCCGACTTTCTCTCACCATCTCGTCTTCGTCGTCGTCGTGCTCCTCTTCGCCCTCGCCATGCAT
TCGGACGCTGCGAGCCTTCCTTCTTTCGCTTCTCGACGAGCCTCACATCCAATTCGGCTCGTCATCGCCGGCGCC
GGCATTGCGGGGCTCGCCACTGGCCTCGGCCTCGGCTTGACGGGCCACGACGTCACCATCCTCGAACAGGCGTCT
AACTTGGACGAGGCTGGTGCCGGCATTCAGATTGCGCCCAACGCCACCCGCGTACTCGCCCGGCTCGGCGTCCTT
GACCAAGTCTTACAGGATGCCGACCCTCTCGAGCGCATATCCATACGACGTTACGCCGACGATGAAGAGCTGGGC
TCGGCCTCGATCATGCCCGGCGCCGCCCGCCGATACGGCGCTCCGGCCCTCGTCATCCACCGCGGCGACCTGCAC
CGCATCCTCCTGACGGCGGCCCGCAGAGCCGGCTGCCGGATCCTCACAGGTCGGCGAGTCGTCGGCATCGAGCCG
GGCCCGCCGCCGCGCATCCAGACGAGCGACGGCGACTGGCACCAGGGAGACGTCGTTCTCGGCGCCGACGGCGTC
CGCTCCGTCCTGCGGGCGTACGTGACGACCAGCAACGGGGAGAGCGACAGCAGCCTCGGCCTCAAGCCCACGGGA
GACGCCGCCTACCGCATGCTGATCCCTCGGGAACGCCTGGCCGGCCACGAAACTCTCGGCGCCCTCGTCGATGGC
CGCGACACGATGCGCTGGCTCGGCCCCCGAGGCCACGTCATGGCCTACCCCGTCCGGCACCAGGCCTTGTACAAC
GTCGTCATCCTGCACCCCATCGACTCGCCCGCCGTGGCCTCGTCGGCCGTCAACGGCCAGGTGCGACGTCCCAAG
TCCGACGCCGTCGACTTCTGCCGCGATTGGTGCCGTCCCGTTCGCGACCTCGTCGCCTGCATGCCCGACGGCGAC
GTCGTCACCGAATGGCTGCTCTACACTCATCCGCCCCTCCCCCGCTGGACCCGTGGCCGCGTCGCCCTCGTCGGA
GACGCCTGCCACCCGATGCTGCCCTACACGGCTCAGGGCGCCGCCTGTGCCATCGAGGATGCCGGCGCTCTCGTG
GCCGCCTTCGCCTGCGGCCTGTCCCCCGACGCCGCCCTGGCCCTCTATCAGCGCGTGCGCAAGCCCGGCTCCGAG
AGCGTCCAGGCCGCCTCGGCCCGCCAGCGCGCCTGTCTGCACCTCCCGGACGGCGCCACCCAGGCCCGTCGGGAC
GACGCCATCCGCCGCGCCCTCGCCGCCCCTCCCGACGATGGCGTCGCGCCCCTGCTGCCCAACCCGGACCTGTGG
GTCGATCGCCGCTGGCAGGACCGTGTCTGGGGATCCGACGTGGTCTACGATGTCTTCCAAGCCTGTATCCGGGAA
ACCGTGTGGCCGCTGTCGACGAGTCTGCGCTGCGTGCTTCCCCTGAGCAGCAGCAGCAGCGGCGGCGGCGGCATC
GCTCCGGAGCCCGATGGCGTCGCGGAATACAGACAACGGGGACGGGCGTCGCAGCCA
Transcript >Ophio5|3906
ATGTGCCTCCTCGTTCGACCATCTTCTCTTCCGTCCTTCGTCGAGCCTCAACCCGACATACGAGACTCCTTTTGG
CATCTGGTGCCGCCGACTTTCTCTCACCATCTCGTCTTCGTCGTCGTCGTGCTCCTCTTCGCCCTCGCCATGCAT
TCGGACGCTGCGAGCCTTCCTTCTTTCGCTTCTCGACGAGCCTCACATCCAATTCGGCTCGTCATCGCCGGCGCC
GGCATTGCGGGGCTCGCCACTGGCCTCGGCCTCGGCTTGACGGGCCACGACGTCACCATCCTCGAACAGGCGTCT
AACTTGGACGAGGCTGGTGCCGGCATTCAGATTGCGCCCAACGCCACCCGCGTACTCGCCCGGCTCGGCGTCCTT
GACCAAGTCTTACAGGATGCCGACCCTCTCGAGCGCATATCCATACGACGTTACGCCGACGATGAAGAGCTGGGC
TCGGCCTCGATCATGCCCGGCGCCGCCCGCCGATACGGCGCTCCGGCCCTCGTCATCCACCGCGGCGACCTGCAC
CGCATCCTCCTGACGGCGGCCCGCAGAGCCGGCTGCCGGATCCTCACAGGTCGGCGAGTCGTCGGCATCGAGCCG
GGCCCGCCGCCGCGCATCCAGACGAGCGACGGCGACTGGCACCAGGGAGACGTCGTTCTCGGCGCCGACGGCGTC
CGCTCCGTCCTGCGGGCGTACGTGACGACCAGCAACGGGGAGAGCGACAGCAGCCTCGGCCTCAAGCCCACGGGA
GACGCCGCCTACCGCATGCTGATCCCTCGGGAACGCCTGGCCGGCCACGAAACTCTCGGCGCCCTCGTCGATGGC
CGCGACACGATGCGCTGGCTCGGCCCCCGAGGCCACGTCATGGCCTACCCCGTCCGGCACCAGGCCTTGTACAAC
GTCGTCATCCTGCACCCCATCGACTCGCCCGCCGTGGCCTCGTCGGCCGTCAACGGCCAGGTGCGACGTCCCAAG
TCCGACGCCGTCGACTTCTGCCGCGATTGGTGCCGTCCCGTTCGCGACCTCGTCGCCTGCATGCCCGACGGCGAC
GTCGTCACCGAATGGCTGCTCTACACTCATCCGCCCCTCCCCCGCTGGACCCGTGGCCGCGTCGCCCTCGTCGGA
GACGCCTGCCACCCGATGCTGCCCTACACGGCTCAGGGCGCCGCCTGTGCCATCGAGGATGCCGGCGCTCTCGTG
GCCGCCTTCGCCTGCGGCCTGTCCCCCGACGCCGCCCTGGCCCTCTATCAGCGCGTGCGCAAGCCCGGCTCCGAG
AGCGTCCAGGCCGCCTCGGCCCGCCAGCGCGCCTGTCTGCACCTCCCGGACGGCGCCACCCAGGCCCGTCGGGAC
GACGCCATCCGCCGCGCCCTCGCCGCCCCTCCCGACGATGGCGTCGCGCCCCTGCTGCCCAACCCGGACCTGTGG
GTCGATCGCCGCTGGCAGGACCGTGTCTGGGGATCCGACGTGGTCTACGATGTCTTCCAAGCCTGTATCCGGGAA
ACCGTGTGGCCGCTGTCGACGAGTCTGCGCTGCGTGCTTCCCCTGAGCAGCAGCAGCAGCGGCGGCGGCGGCATC
GCTCCGGAGCCCGATGGCGTCGCGGAATACAGACAACGGGGACGGGCGTCGCAGCCATAA
Gene >Ophio5|3906
ATGTGCCTCCTCGTTCGACCATCTTCTCTTCCGTCCTTCGTCGAGCCTCAACCCGACATGTTTCATCGGCGCCCG
AACTCGAAGCGGCCGGCTCCGACGTCCGCCTCGGCCCCGATGAGGCCGCTCGTCCGGGTCAACGGCCACCTCGGC
TGAGACGCAGCATACTATATTGGACATGGTGCAGCCGTGGCGGCTCCCTGACGCAGACGAGACTCCTTTTGGCAT
CTGGTGCCGCCGACTTTCTCTCACGTCAGCATATTCGTACAAAGAAAAGCGCCAGGAGTCGCAATGCCTCCGTTT
CACGACACTGACTCGGCGAACAAAAGCATCTCGTCTTCGTCGTCGTCGTGCTCCTCTTCGCCCTCGCCATGCATT
CGGACGCTGCGAGCCTTCCTTCTTTCGCTTCTCGACGAGCCTCACATCCAATTCGGCTCGTCATCGCCGGCGCCG
GCATTGCGGGGCTCGCCACTGGCCTCGGCCTCGGCTTGACGGGCCACGACGTCACCATCCTCGAACAGGCGTCTA
ACTTGGACGAGGCTGGTGCCGGCATTCAGATTGCGCCCAACGCCACCCGCGTACTCGCCCGGCTCGGCGTCCTTG
ACCAAGTCTTACAGGATGCCGACCCTCTCGAGCGCATATCCATACGGCAAGCCCCCTCCCTACGCGTGCCGAGGA
AGATGAAGACAGGGAGGGGGGAAGGGGAAAACGTGACGAGCTGCGGCTGAGACCCCTTTCGAAATAGACGTTACG
CCGACGATGAAGAGCTGGGCTCGGCCTCGATCATGCCCGGCGCCGCCCGCCGATACGGCGCTCCGGCCCTCGTCA
TCCACCGCGGCGACCTGCACCGCATCCTCCTGACGGCGGCCCGCAGAGCCGGCTGCCGGATCCTCACAGGTCGGC
GAGTCGTCGGCATCGAGCCGGGCCCGCCGCCGCGCATCCAGACGAGCGACGGCGACTGGCACCAGGGAGACGTCG
TTCTCGGCGCCGACGGCGTCCGCTCCGTCCTGCGGGCGTACGTGACGACCAGCAACGGGGAGAGCGACAGCAGCC
TCGGCCTCAAGCCCACGGGAGACGCCGCCTACCGCATGCTGATCCCTCGGGAACGCCTGGCCGGCCACGAAACTC
TCGGCGCCCTCGTCGATGGCCGCGACACGATGCGCTGGCTCGGCCCCCGAGGCCACGTCATGGCCTACCCCGTCC
GGCACCAGGCCTTGTACAACGTCGTCATCCTGCACCCCATCGACTCGCCCGCCGTGGCCTCGTCGGCCGTCAACG
GCCAGGTGCGACGTCCCAAGTCCGACGCCGTCGACTTCTGCCGCGATTGGTGCCGTCCCGTTCGCGACCTCGTCG
CCTGCATGCCCGACGGCGACGTCGTCACCGAATGGCTGCTCTACACTCATCCGCCCCTCCCCCGCTGGACCCGTG
GCCGCGTCGCCCTCGTCGGAGACGCCTGCCACCCGATGCTGCCCTACACGGCTCAGGGCGCCGCCTGTGCCATCG
AGGATGCCGGCGCTCTCGTGGCCGCCTTCGCCTGCGGCCTGTCCCCCGACGCCGCCCTGGCCCTCTATCAGCGCG
TGCGCAAGCCCGGCTCCGAGAGCGTCCAGGCCGCCTCGGCCCGCCAGCGCGCCTGTCTGCACCTCCCGGACGGCG
CCACCCAGGCCCGTCGGGACGACGCCATCCGCCGCGCCCTCGCCGCCCCTCCCGACGATGGCGTCGCGCCCCTGC
TGCCCAACCCGGACCTGTGGGTCGATCGCCGCTGGCAGGACCGTGTCTGGGGATCCGACGTGGTCTACGATGTCT
TCCAAGCCTGTATCCGGGAAACCGTGTGGCCGCTGTCGACGAGTCTGCGCTGCGTGCTTCCCCTGAGCAGCAGCA
GCAGCGGCGGCGGCGGCATCGCTCCGGAGCCCGATGGCGTCGCGGAATACAGACAACGGGGACGGGCGTCGCAGC
CATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail