Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3905
Gene name
Locationscaffold_304:22440..23908
Strand+
Gene length (bp)1468
Transcript length (bp)1047
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13358 DDE_3 DDE superfamily endonuclease 2.8E-11 160 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P34257|TC3A_CAEEL Transposable element Tc3 transposase OS=Caenorhabditis elegans GN=tc3a PE=1 SV=1 166 238 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3905
MALWKPLLPPVTYQPRLTDPFYNRKKTLAQKLYAASLGRRLFLISSSKLVFRDVEAYEVCLSHSVLRPGNQFLCV
CADEVVATKRYHKFEQARTQEAMLLQAVSHVRGNPDYLTRDINVTHLIKQKNEATNVFISCARISKAHLQEVILP
RHISFRPADAPLTIVKPGYTLVQDNAPVHIVRSVQNQLANFLEENWVESVDWPPYSPHLNPIENLWKILQERIFK
QYPDIAIPTQKQGSKRQPPSKSFVSRAALPDTRPERCPGGTRNCPGLAPDLPRHGPGVAPELGRTRPEADPKRTR
LGAEFSPPFPLFRILGLLVYRQYTVEQNPISPLTPTYITYNPFTAIEE
Coding >Ophio5|3905
ATGGCCTTATGGAAACCATTATTACCTCCCGTCACCTATCAACCTCGCTTAACCGACCCTTTCTACAATAGGAAG
AAAACGCTGGCTCAAAAGCTCTACGCCGCTAGTCTAGGCAGGCGCCTATTTCTCATTTCCTCGTCAAAACTGGTC
TTCCGGGACGTGGAAGCCTACGAAGTTTGTCTCTCGCACTCAGTTCTACGCCCAGGAAACCAGTTCTTGTGTGTC
TGCGCGGACGAGGTCGTCGCTACGAAGCGATATCACAAGTTCGAACAGGCCAGAACACAGGAAGCCATGCTGCTC
CAGGCTGTTTCTCATGTGCGCGGCAACCCTGACTACCTAACAAGAGATATCAACGTCACCCATCTTATCAAGCAG
AAGAATGAAGCGACCAACGTCTTCATATCATGTGCCAGAATTTCGAAGGCACATTTGCAGGAAGTGATATTGCCG
AGACACATCTCTTTCCGACCCGCCGATGCACCTCTAACGATCGTTAAGCCCGGCTATACCCTCGTTCAAGATAAC
GCCCCCGTACACATAGTCCGATCGGTGCAGAATCAGCTCGCCAATTTCCTCGAAGAGAATTGGGTCGAATCGGTA
GATTGGCCGCCATATTCACCCCATCTTAATCCTATTGAAAACCTATGGAAGATACTACAGGAAAGGATCTTTAAA
CAATATCCCGATATTGCAATTCCTACGCAAAAGCAAGGCTCGAAGAGGCAGCCTCCTTCGAAGTCCTTTGTGTCA
CGGGCTGCACTGCCCGACACAAGGCCAGAGCGATGCCCTGGCGGGACCAGGAACTGCCCCGGACTTGCCCCGGAC
TTGCCCCGGCATGGACCCGGAGTTGCCCCTGAGTTGGGCCGGACTCGGCCCGAGGCCGACCCAAAAAGGACCCGG
CTCGGCGCAGAGTTTTCTCCTCCTTTTCCTCTCTTCCGTATCTTGGGATTACTTGTGTATAGGCAATATACGGTT
GAGCAAAACCCTATTTCGCCTCTCACACCGACGTATATCACATACAACCCTTTTACAGCAATCGAGGAA
Transcript >Ophio5|3905
ATGGCCTTATGGAAACCATTATTACCTCCCGTCACCTATCAACCTCGCTTAACCGACCCTTTCTACAATAGGAAG
AAAACGCTGGCTCAAAAGCTCTACGCCGCTAGTCTAGGCAGGCGCCTATTTCTCATTTCCTCGTCAAAACTGGTC
TTCCGGGACGTGGAAGCCTACGAAGTTTGTCTCTCGCACTCAGTTCTACGCCCAGGAAACCAGTTCTTGTGTGTC
TGCGCGGACGAGGTCGTCGCTACGAAGCGATATCACAAGTTCGAACAGGCCAGAACACAGGAAGCCATGCTGCTC
CAGGCTGTTTCTCATGTGCGCGGCAACCCTGACTACCTAACAAGAGATATCAACGTCACCCATCTTATCAAGCAG
AAGAATGAAGCGACCAACGTCTTCATATCATGTGCCAGAATTTCGAAGGCACATTTGCAGGAAGTGATATTGCCG
AGACACATCTCTTTCCGACCCGCCGATGCACCTCTAACGATCGTTAAGCCCGGCTATACCCTCGTTCAAGATAAC
GCCCCCGTACACATAGTCCGATCGGTGCAGAATCAGCTCGCCAATTTCCTCGAAGAGAATTGGGTCGAATCGGTA
GATTGGCCGCCATATTCACCCCATCTTAATCCTATTGAAAACCTATGGAAGATACTACAGGAAAGGATCTTTAAA
CAATATCCCGATATTGCAATTCCTACGCAAAAGCAAGGCTCGAAGAGGCAGCCTCCTTCGAAGTCCTTTGTGTCA
CGGGCTGCACTGCCCGACACAAGGCCAGAGCGATGCCCTGGCGGGACCAGGAACTGCCCCGGACTTGCCCCGGAC
TTGCCCCGGCATGGACCCGGAGTTGCCCCTGAGTTGGGCCGGACTCGGCCCGAGGCCGACCCAAAAAGGACCCGG
CTCGGCGCAGAGTTTTCTCCTCCTTTTCCTCTCTTCCGTATCTTGGGATTACTTGTGTATAGGCAATATACGGTT
GAGCAAAACCCTATTTCGCCTCTCACACCGACGTATATCACATACAACCCTTTTACAGCAATCGAGGAATAG
Gene >Ophio5|3905
ATGGCCTTATGGAAACCATTATTACCTCCCGTCACCTATCAACCTCGCTTAACCGACCCTTTCTACAATAGGAAG
AAAACGCTGGCTCAAGTACTCGTCGGAAAACTAACCCCTTCCTCCCAAGGAATATAACCTTGTGCAGTATCTACC
TTAAGGCCCTCGAGCGCCTCTATCTCCGAACGAGGATACCGATCTTCCGCGAAGAGCGACGCGAAGCCGCGGCGA
GGTACTAAATTTACGAAGTCGGTTCGTTCCCCGACACGCTTTCGATCCGCCCATATTATTATTATTCCGAAACTG
CACAGAAGCTCTACGCCGCTAGTCTAGGCAGGTAGTGTAATGACCATCATTCCGAAACCGGGTACACCTGTCGCT
AAAGCTTCGCCATCTCGTCTTTCAACTCTTTGATAGGCGCCTATTTCTCATTTCCTCGTCAAAACTGGTCTTCCG
GGACGTGGTCCGCCTTTCCTAGCACGTCTCACGACCACGGATGCAACTCTACCGCGATCCGCCGGCTGCCAATGA
AGCAGGAAGCCTACGAAGTTTGTCTCTCGCACTCAGTTCTACGCCCAGGAAACCAGTTCTTGTGTGTCTGCGCGG
ACGAGGTCGTCGCTACGAAGCGATATCACAAGTTCGAACAGGCCAGAACACAGGAAGCCATGCTGCTCCAGGCTG
TTTCTCATGTGCGCGGCAACCCTGACTACCTAACAAGAGATATCAACGTCACCCATCTTATCAAGCAGAAGAATG
AAGCGACCAACGTGTTAGCTTCAACTTGTGTCTGGCGGCTACGGCTCAATTACACTCTCCGAACAGCTTCATATC
ATGTGCCAGAATTTCGAAGGCACATTTGCAGGAAGTGATATTGCCGAGACACATCTCTTTCCGACCCGCCGATGC
ACCTCTAACGATCGTTAAGCCCGGCTATACCCTCGTTCAAGATAACGCCCCCGTACACATAGTCCGATCGGTGCA
GAATCAGCTCGCCAATTTCCTCGAAGAGAATTGGGTCGAATCGGTAGATTGGCCGCCATATTCACCCCATCTTAA
TCCTATTGAAAACCTATGGAAGATACTACAGGAAAGGATCTTTAAACAATATCCCGATATTGCAATTCCTACGCA
AAAGCAAGGCTCGAAGAGGCAGCCTCCTTCGAAGTCCTTTGTGTCACGGGCTGCACTGCCCGACACAAGGCCAGA
GCGATGCCCTGGCGGGACCAGGAACTGCCCCGGACTTGCCCCGGACTTGCCCCGGCATGGACCCGGAGTTGCCCC
TGAGTTGGGCCGGACTCGGCCCGAGGCCGACCCAAAAAGGACCCGGCTCGGCGCAGAGTTTTCTCCTCCTTTTCC
TCTCTTCCGTATCTTGGGATTACTTGTGTATAGGCAATATACGGTTGAGCAAAACCCTATTTCGCCTCTCACACC
GACGTATATCACATACAACCCTTTTACAGCAATCGAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail