Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3896
Gene name
Locationscaffold_303:12775..14120
Strand+
Gene length (bp)1345
Transcript length (bp)1149
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain 1.3E-34 29 146
PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein 5.1E-08 166 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O15527|OGG1_HUMAN N-glycosylase/DNA lyase OS=Homo sapiens GN=OGG1 PE=1 SV=2 10 315 2.0E-65
sp|O08760|OGG1_MOUSE N-glycosylase/DNA lyase OS=Mus musculus GN=Ogg1 PE=2 SV=2 6 318 8.0E-63
sp|O70249|OGG1_RAT N-glycosylase/DNA lyase OS=Rattus norvegicus GN=Ogg1 PE=2 SV=1 19 315 1.0E-62
sp|P53397|OGG1_YEAST N-glycosylase/DNA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OGG1 PE=1 SV=1 29 314 7.0E-50
sp|Q9V3I8|OGG1_DROME N-glycosylase/DNA lyase OS=Drosophila melanogaster GN=Ogg1 PE=2 SV=2 30 319 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O15527|OGG1_HUMAN N-glycosylase/DNA lyase OS=Homo sapiens GN=OGG1 PE=1 SV=2 10 315 2.0E-65
sp|O08760|OGG1_MOUSE N-glycosylase/DNA lyase OS=Mus musculus GN=Ogg1 PE=2 SV=2 6 318 8.0E-63
sp|O70249|OGG1_RAT N-glycosylase/DNA lyase OS=Rattus norvegicus GN=Ogg1 PE=2 SV=1 19 315 1.0E-62
sp|P53397|OGG1_YEAST N-glycosylase/DNA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OGG1 PE=1 SV=1 29 314 7.0E-50
sp|Q9V3I8|OGG1_DROME N-glycosylase/DNA lyase OS=Drosophila melanogaster GN=Ogg1 PE=2 SV=2 30 319 2.0E-45
sp|Q9FNY7|OGG1_ARATH N-glycosylase/DNA lyase OGG1 OS=Arabidopsis thaliana GN=OGG1 PE=1 SV=1 6 314 5.0E-45
sp|O27397|OGG1_METTH Probable N-glycosylase/DNA lyase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1342 PE=3 SV=1 95 311 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0003684 damaged DNA binding Yes
GO:0006284 base-excision repair Yes
GO:0003676 nucleic acid binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0019104 DNA N-glycosylase activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003677 DNA binding No
GO:0046483 heterocycle metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0006259 DNA metabolic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0140097 catalytic activity, acting on DNA No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0006950 response to stress No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0003824 catalytic activity No
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds No
GO:0006281 DNA repair No
GO:0000702 oxidized base lesion DNA N-glycosylase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0051716 cellular response to stimulus No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3896
MRLCKFSSRLRPQLRSMTTAVKRTAEWRKIPVSLSELCIDTTLRCGQAFRWRKIDGEWTSTLNGRILSLKQDADH
LHYKVTWPPPSCPVACCESDDTECILSRYFSLDLHLGTLYAKWSAADSNFRKKAASLTGVRILSQDAWETLICFI
CSSNNNISRISQMVHKLFESHLRELGFGYRAKYIAETAREIALAKPAMWLESLRNPAHQGLQDGRGSRAEYRKST
YRDAHNALLSLSGVGPKVADCVCLMGLGWGESVPVDTHVWQIAQRDYKFGKAKSKSFNKALYDAVGDHFRAIWGE
YAGWAHSVLFTADLRTFSNREAASMSVAAEGSRLKVAEEVQAVESRKKRAFKVEVKVEASQLEAAADMTPKRRRT
RQDFKIS
Coding >Ophio5|3896
ATGAGGCTGTGCAAGTTCTCTTCCCGACTTCGACCACAGCTTCGGAGTATGACCACAGCCGTCAAACGAACCGCC
GAGTGGCGCAAGATTCCCGTCAGCCTTTCCGAGCTGTGCATCGACACAACGCTTCGATGCGGACAGGCTTTTCGG
TGGCGGAAGATAGATGGCGAATGGACAAGCACCCTCAATGGGCGCATACTGTCTCTGAAGCAAGACGCTGACCAT
CTGCATTACAAAGTAACTTGGCCTCCTCCGTCTTGCCCCGTCGCCTGCTGCGAAAGCGACGATACAGAGTGTATT
CTGTCTCGCTACTTCAGCCTGGATTTGCATCTCGGAACTCTCTACGCCAAGTGGTCGGCGGCAGACTCCAATTTC
CGCAAGAAAGCGGCGAGCCTAACCGGCGTGCGCATCCTCAGCCAGGACGCCTGGGAAACGCTGATATGCTTCATA
TGCAGCAGCAACAATAACATCAGCCGTATATCTCAAATGGTTCACAAACTATTCGAATCGCACCTGCGAGAGCTC
GGCTTCGGATACCGAGCAAAGTACATCGCCGAAACGGCCCGGGAGATTGCTCTGGCAAAGCCGGCAATGTGGCTT
GAGTCGCTGCGAAACCCTGCACACCAAGGCTTGCAGGATGGAAGGGGATCGAGGGCGGAGTACCGGAAATCGACA
TACAGAGATGCCCATAACGCTCTACTGTCTCTTTCCGGGGTTGGGCCCAAAGTCGCCGACTGCGTCTGCTTGATG
GGGCTGGGTTGGGGTGAATCTGTGCCCGTCGACACCCATGTCTGGCAAATCGCCCAGAGGGACTACAAGTTTGGG
AAAGCCAAGTCTAAGTCTTTTAACAAGGCTCTGTATGATGCCGTCGGAGACCACTTCAGAGCCATATGGGGGGAG
TATGCGGGCTGGGCACATTCTGTCCTCTTCACCGCCGACCTTCGTACGTTTTCGAATCGTGAAGCAGCCAGTATG
AGCGTTGCAGCCGAGGGAAGTCGGTTGAAAGTTGCGGAAGAGGTGCAAGCGGTTGAATCCCGCAAGAAGCGAGCC
TTCAAGGTGGAAGTCAAGGTTGAAGCCTCTCAATTAGAGGCAGCAGCAGACATGACCCCAAAGAGGAGGCGGACG
CGGCAAGATTTTAAAATTTCT
Transcript >Ophio5|3896
ATGAGGCTGTGCAAGTTCTCTTCCCGACTTCGACCACAGCTTCGGAGTATGACCACAGCCGTCAAACGAACCGCC
GAGTGGCGCAAGATTCCCGTCAGCCTTTCCGAGCTGTGCATCGACACAACGCTTCGATGCGGACAGGCTTTTCGG
TGGCGGAAGATAGATGGCGAATGGACAAGCACCCTCAATGGGCGCATACTGTCTCTGAAGCAAGACGCTGACCAT
CTGCATTACAAAGTAACTTGGCCTCCTCCGTCTTGCCCCGTCGCCTGCTGCGAAAGCGACGATACAGAGTGTATT
CTGTCTCGCTACTTCAGCCTGGATTTGCATCTCGGAACTCTCTACGCCAAGTGGTCGGCGGCAGACTCCAATTTC
CGCAAGAAAGCGGCGAGCCTAACCGGCGTGCGCATCCTCAGCCAGGACGCCTGGGAAACGCTGATATGCTTCATA
TGCAGCAGCAACAATAACATCAGCCGTATATCTCAAATGGTTCACAAACTATTCGAATCGCACCTGCGAGAGCTC
GGCTTCGGATACCGAGCAAAGTACATCGCCGAAACGGCCCGGGAGATTGCTCTGGCAAAGCCGGCAATGTGGCTT
GAGTCGCTGCGAAACCCTGCACACCAAGGCTTGCAGGATGGAAGGGGATCGAGGGCGGAGTACCGGAAATCGACA
TACAGAGATGCCCATAACGCTCTACTGTCTCTTTCCGGGGTTGGGCCCAAAGTCGCCGACTGCGTCTGCTTGATG
GGGCTGGGTTGGGGTGAATCTGTGCCCGTCGACACCCATGTCTGGCAAATCGCCCAGAGGGACTACAAGTTTGGG
AAAGCCAAGTCTAAGTCTTTTAACAAGGCTCTGTATGATGCCGTCGGAGACCACTTCAGAGCCATATGGGGGGAG
TATGCGGGCTGGGCACATTCTGTCCTCTTCACCGCCGACCTTCGTACGTTTTCGAATCGTGAAGCAGCCAGTATG
AGCGTTGCAGCCGAGGGAAGTCGGTTGAAAGTTGCGGAAGAGGTGCAAGCGGTTGAATCCCGCAAGAAGCGAGCC
TTCAAGGTGGAAGTCAAGGTTGAAGCCTCTCAATTAGAGGCAGCAGCAGACATGACCCCAAAGAGGAGGCGGACG
CGGCAAGATTTTAAAATTTCTTGA
Gene >Ophio5|3896
ATGAGGCTGTGCAAGTTCTCTTCCCGACTTCGACCACAGCTTCGGAGTATGACCACAGCCGTCAAACGAACCGCC
GAGTGGCGCAAGATTCCCGTCAGCCTTTCCGAGCTGTGCATCGACACAACGCTTCGATGCGGACAGGCTTTTCGG
TGGCGGAAGATAGATGGCGAATGGTGCTGTCCAGCAACCCACCTTGCCCGGTGCAGCTACTAATCCAGATGCTGC
AGGACAAGCACCCTCAATGGGCGCATACTGTCTCTGAAGCAAGACGCTGACCATCTGCATTACAAAGTAACTTGG
CCTCCTCCGTCTTGCCCCGTCGCCTGCTGCGAAAGCGACGATACAGAGTGTATTCTGTCTCGCTACTTCAGCCTG
GATTTGCATCTCGGAACTCTCTACGCCAAGTGGTCGGCGGCAGACTCCAATTTCCGCAAGAAAGCGGCGAGCCTA
ACCGGCGTGCGCATCCTCAGCCAGGACGCCTGGGAAACGCTGATATGCTTCATATGCAGCAGCAACAATAACATC
AGCCGTATATCTCAAATGGTATTCTCTACCGACGCAAAGGCAACTCGTCCGCAACTAACGGGACGGCCATCAGGT
TCACAAACTATGTAGGTATTACGGCCCGCTCATCGGACATGCCGGAGAAGAAGCCCTCCATGACTTCCCGACCCC
AGAATCACTCACTGGATCCCAAGTCGAATCGCACCTGCGAGAGCTCGGCTTCGGATACCGAGCAAAGTACATCGC
CGAAACGGCCCGGGAGATTGCTCTGGCAAAGCCGGCAATGTGGCTTGAGTCGCTGCGAAACCCTGCACACCAAGG
CTTGCAGGATGGAAGGGGATCGAGGGCGGAGTACCGGAAATCGACATACAGAGATGCCCATAACGCTCTACTGTC
TCTTTCCGGGGTTGGGCCCAAAGTCGCCGACTGCGTCTGCTTGATGGGGCTGGGTTGGGGTGAATCTGTGCCCGT
CGACACCCATGTCTGGCAAATCGCCCAGAGGGACTACAAGTTTGGGAAAGCCAAGTCTAAGTCTTTTAACAAGGC
TCTGTATGATGCCGTCGGAGACCACTTCAGAGCCATATGGGGGGAGTATGCGGGCTGGGCACATTCTGTCCTCTT
CACCGCCGACCTTCGTACGTTTTCGAATCGTGAAGCAGCCAGTATGAGCGTTGCAGCCGAGGGAAGTCGGTTGAA
AGTTGCGGAAGAGGTGCAAGCGGTTGAATCCCGCAAGAAGCGAGCCTTCAAGGTGGAAGTCAAGGTTGAAGCCTC
TCAATTAGAGGCAGCAGCAGACATGACCCCAAAGAGGAGGCGGACGCGGCAAGATTTTAAAATTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail